(data stored in SCRATCH zone)

EMBL: AF146075

ID   AF146075; SV 1; linear; genomic DNA; STD; PRO; 2143 BP.
XX
AC   AF146075;
XX
DT   24-JAN-2000 (Rel. 62, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Thermus thermophilus S6 ribosomal gene cluster.
XX
KW   .
XX
OS   Thermus thermophilus
OC   Bacteria; Deinococcus-Thermus; Deinococci; Thermales; Thermaceae; Thermus.
XX
RN   [1]
RP   1-2143
RA   Shcherbakov D.V., Cherepanova E.A., Garber M.B.;
RT   "Sequencing and analysis of the Thermus thermophilus gene cluster
RT   equivalent to the S6 operon";
RL   Unpublished.
XX
RN   [2]
RP   1-2143
RA   Shcherbakov D.V., Cherepanova E.A., Garber M.B.;
RT   ;
RL   Submitted (27-APR-1999) to the INSDC.
RL   Group for Structural Studies of the Translational Apparatus, Institute of
RL   Protein Research RAS, Pushchino 142292, Russia
XX
DR   MD5; 2863fd00ce5e2841b003e5322999ce66.
DR   RFAM; RF00005; tRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2143
FT                   /organism="Thermus thermophilus"
FT                   /strain="VK1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:274"
FT   CDS_pept        238..543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps6"
FT                   /product="ribosomal protein S6"
FT                   /note="subunit of 30S ribosome."
FT                   /db_xref="GOA:P23370"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="PDB:1CQM"
FT                   /db_xref="PDB:1CQN"
FT                   /db_xref="PDB:1LOU"
FT                   /db_xref="PDB:1QJH"
FT                   /db_xref="PDB:1RIS"
FT                   /db_xref="PDB:1TWT"
FT                   /db_xref="PDB:2BVZ"
FT                   /db_xref="PDB:2BXJ"
FT                   /db_xref="PDB:4V8X"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23370"
FT                   /protein_id="AAF27295.1"
FT                   /translation="MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGL
FT                   RRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA"
FT   CDS_pept        553..1353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /product="SSB protein"
FT                   /note="binds single strand DNA during replication."
FT                   /db_xref="GOA:O85824"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:O85824"
FT                   /protein_id="AAF27296.1"
FT                   /translation="MARGLNRVFLIGALATRPDMRYTPAGLAILDLTLAGQDLLLSDNG
FT                   GEPEVSWYHRVRLLGRQAEMWGDLLDQGQLVFVEGRLEYRQWEREGEKRSELQIRADFL
FT                   DPLDDRGKKRAEDSRGQPRLRAALNQVFLMGNLTRDPELRYTPQGTAVARLGLAVNERR
FT                   QGAEERTHFVEVQAWRDLAEWAAELRKGDGLFVIGRLVNDSWTSSSGERRFQTRVEALR
FT                   LERPTRGPAQACPGRRNRSREVQTGGVDIDEGLEDFPPEEDLPF"
FT   CDS_pept        1350..1616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps18"
FT                   /product="ribosomal protein S18"
FT                   /note="subunit of 30S ribosome."
FT                   /db_xref="GOA:P80382"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="PDB:1TWT"
FT                   /db_xref="PDB:2VQE"
FT                   /db_xref="PDB:2VQF"
FT                   /db_xref="PDB:5A9Z"
FT                   /db_xref="PDB:5IMQ"
FT                   /db_xref="PDB:5IMR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80382"
FT                   /protein_id="AAF27297.1"
FT                   /translation="MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLS
FT                   ETGKILPRRRTGLSGKEQRILAKTIKRARILGLLPFTEKLVRK"
FT   CDS_pept        1627..2073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl9"
FT                   /product="ribosomal protein L9"
FT                   /note="subunit of 50S ribosome."
FT                   /db_xref="GOA:P27151"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27151"
FT                   /protein_id="AAF27298.1"
FT                   /translation="MKVILLEPLENLGDVGQVVDVKPGYARNYLLPRGLAVLATESNLK
FT                   ALEARIRAQAKRLAERKAEAERLKKILENLTLTIPVRAGETKIYGSVTAKDIAEALSRQ
FT                   HGVTIDPKRLALEKPIKELGEYVLTYKPHPEVPIQLKVSVVAQE"
XX
SQ   Sequence 2143 BP; 383 A; 673 C; 774 G; 313 T; 0 other;
     gcgcttgacg gggccacggg ggggttggta tagtgggcgt tgcggtgcgg tgcggtccgc        60
     ggtccgcggt agctcagcag gtagagcagc cggctgttaa ccggtaggtc gcaggttcga       120
     gtcctgcccg cggagccaga aaggggggcc taggcccccc tgggtctttt ttttccgggg       180
     gaaggcgggg tataatctgg ctctgtgcgg cctgccgggc ccggaaggga ggtgaagatg       240
     cgcaggtacg aggtgaacat cgtcctgaac cccaacctgg accagagcca gctcgccctg       300
     gagaaggaga tcatccagcg ggctctggag aactacggcg cccgcgtgga gaaggtggag       360
     gagctggggc ttcgccgcct ggcctacccc atcgccaagg acccccaggg ctacttcctc       420
     tggtaccagg tggagatgcc cgaggaccgg gtgaacgacc tggcccggga gctccgcatc       480
     cgggacaacg tgcgccgggt catggtggtg aagtcccagg agcccttcct cgccaacgcg       540
     taaactgttg acatggctcg aggcctgaac cgcgttttcc tcatcggcgc cctcgccacc       600
     cggccggaca tgcgctacac cccggcgggg ctcgccattt tggacctgac cctcgccggt       660
     caggacctgc ttctttccga taacgggggg gaaccggagg tgtcctggta ccaccgggtg       720
     aggctcttag gccgccaggc ggagatgtgg ggcgacctct tggaccaagg gcagctcgtc       780
     ttcgtggagg gccgcctgga gtaccgccag tgggaaaggg agggggagaa gcggagcgag       840
     ctccagatcc gggccgactt cctggacccc ctggacgacc gggggaagaa gcgggcggag       900
     gacagccggg gccagcccag gctccgcgcc gccctgaacc aggtcttcct catgggcaac       960
     ctgacccggg acccggaact ccgctacacc ccccagggca ccgcggtggc ccggctgggc      1020
     ctggcggtga acgagcgccg ccagggggcg gaggagcgca cccacttcgt ggaggttcag      1080
     gcctggcgcg acctggcgga gtgggccgcc gagctgagga agggcgacgg ccttttcgtg      1140
     atcggcaggt tggtgaacga ctcctggacc agctccagcg gcgagcggcg cttccagacc      1200
     cgtgtggagg ccctcaggct ggagcgcccc acccgtggac ctgcccaggc ctgcccaggc      1260
     cggcggaaca ggtcccgcga agtccagacg ggtggggtgg acattgacga aggcttggaa      1320
     gactttccgc cggaggagga tttgccgttt tgagcacgaa gaacgcgaaa cccaagaagg      1380
     aggcgcagag gcgcccgtcc cgcaaggcta aggtcaaggc caccctgggg gagtttgacc      1440
     tcagggacta ccggaacgtg gaggtgctca agcggttcct gtcggagacg gggaagattc      1500
     ttccccgccg ccgcacgggg ctttccggaa aggagcagag gatcctggcc aagaccatca      1560
     agcgggcgag gatcctaggg ctcctgccct tcacggagaa gctggtgcgg aagtaggggg      1620
     tgaacggtga aggtcatcct cctagaaccc ctggagaacc tgggcgacgt gggccaggtg      1680
     gtggacgtga agccggggta cgccaggaac tacctcctgc cccggggcct cgccgtcttg      1740
     gccacggaga gcaacctcaa ggccctcgag gcccggatcc gcgcccaggc caagcgcctg      1800
     gcggagcgga aggccgaggc ggagcggctt aagaagatcc tggagaacct caccctcacc      1860
     atcccggtgc gggcggggga gaccaagatc tacggctccg tcaccgccaa ggacatcgcc      1920
     gaggcccttt cccgccagca cggcgtcacc attgacccca agcgcctggc gctggaaaag      1980
     cccatcaagg agcttgggga gtacgtcctc acctacaagc cccaccccga ggtccccatc      2040
     cagctcaagg tgagcgtggt ggcccaggag taggggcaaa ccccttaggc ccctccccgc      2100
     ccccccttgg ggcggggggt tgtccttggc gaggaagtgg ggg                        2143
//

If you have problems or comments...

PBIL Back to PBIL home page