(data stored in ACNUC16935 zone)

EMBL: AF146189

ID   AF146189; SV 4; linear; genomic DNA; STD; FUN; 2878 BP.
XX
AC   AF146189;
XX
DT   20-JUL-1999 (Rel. 60, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Aspergillus nidulans mitochondrial transport protein (amc-1) and
DE   coiled-coil protein (cgrA) genes, complete cds.
XX
KW   .
XX
OS   Aspergillus nidulans
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-2878
RX   PUBMED; 9773270.
RA   Sun J., Rhodes J.C., Askew D.S.;
RT   "Sequencing of a gene encoding a member of the mitochondrial carrier family
RT   of transport proteins from Aspergillus nidulans";
RL   DNA Seq 9(1):1-8(1998).
XX
RN   [2]
RP   1-2878
RA   Sun J., Askew D.S.;
RT   ;
RL   Submitted (27-APR-1999) to the INSDC.
RL   Pathology, University of Cincinnati, 231 Bethesda Ave., Cincinnati, OH
RL   45267-0529, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-2878
RA   Sun J., Askew D.S.;
RT   ;
RL   Submitted (03-AUG-2000) to the INSDC.
RL   Pathology, University of Cincinnati, 231 Bethesda Ave., Cincinnati, OH
RL   45267-0529, USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-2878
RA   Sun J., Askew D.S.;
RT   ;
RL   Submitted (08-SEP-2000) to the INSDC.
RL   Pathology, University of Cincinnati, 231 Bethesda Ave., Cincinnati, OH
RL   45267-0529, USA
XX
DR   MD5; 68dbca4f05cf0f0ee558303d15547217.
DR   StrainInfo; 598196; 0.
XX
CC   On Sep 8, 2000 this sequence version replaced gi:9665273.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2878
FT                   /organism="Aspergillus nidulans"
FT                   /chromosome="VII"
FT                   /strain="FGSC A4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:162425"
FT   CDS_pept        complement(179..1336)
FT                   /codon_start=1
FT                   /gene="amc-1"
FT                   /product="mitochondrial transport protein"
FT                   /note="similar to GenBank Accession Number U71603"
FT                   /db_xref="GOA:Q92228"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q92228"
FT                   /protein_id="AAD44763.1"
FT                   /translation="MAATESALTIHNDISMELPELAPNQGLEAFKDILFGSAAGMIGKV
FT                   IEYPFDTVKVRLQSQPDHLPLRYNGPLDCFRQSFQAEGLRGLYRGISAPMAGAAVENSC
FT                   LFFSYRVVQELLQASYYSSTEPLPLTALVFSGAASGSITSLALTPIELIKCKMQVPSEP
FT                   SSARVGPLKIIVSVFRQDGVLGFWRGQLGTLIRETGGGAAWFGGYEGVSALFRSYHYSP
FT                   STTFSSEVESGSLPLYQQMLAGAAAGVSYNFLFYPADTIKSRLQTEDINNTSSKRQTFG
FT                   GAARLSGMSKDFAAYIEAVVSLVRGLPQARHSFLHYLKAYGVTLDERIRYVIRFDFDSR
FT                   RFFGPFLLIDDTYDLSRLRFSCLIIRLFNQLALGPRSKVRWRKET"
FT   exon            1834..1958
FT                   /gene="cgrA"
FT                   /number=1
FT   5'UTR           1834..1900
FT                   /gene="cgrA"
FT   mRNA            join(1834..1958,2038..2183,2254..2657)
FT                   /gene="cgrA"
FT   CDS_pept        join(1901..1958,2038..2183,2254..2394)
FT                   /codon_start=1
FT                   /gene="cgrA"
FT                   /product="coiled-coil protein"
FT                   /db_xref="GOA:Q9Y708"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y708"
FT                   /protein_id="AAD44762.2"
FT                   /translation="MSSAAPAPSTHAAKSIRKNGKNWHDNKKPFRPNGGLTSYTKRAAA
FT                   RKEQEAIKEYEKELREEREAERQAHIQRIKERRAAKEEKERYEKMAEKMHRKRVERLKK
FT                   REKRNKLLNS"
FT   exon            2038..2183
FT                   /gene="cgrA"
FT                   /number=2
FT   exon            2254..2657
FT                   /gene="cgrA"
FT                   /number=3
FT   3'UTR           2395..2657
FT                   /gene="cgrA"
FT   polyA_site      2657
FT                   /gene="cgrA"
XX
SQ   Sequence 2878 BP; 788 A; 679 C; 746 G; 665 T; 0 other;
     gtaggaaatt aaggcaaaag ctgggtagat aatgaggagc aaggaacatt cccatgttac        60
     attggagtca gggcgtcttc caggttatct accccaccaa acttattggt cacagcttct       120
     tcccgcgtta caattcctgc gctatttggt agatgtgtgg tacattcaca tagacaatct       180
     atgtctcttt cctccaacgg acttttgacc gcggccccaa tgccagttgg ttgaacagac       240
     gaatgatcaa acaagaaaat ctaagtctag acaaatcata ggtatcatca ataagcagaa       300
     atgggccaaa aaatcgtcga gaatcaaaat caaatctaat cacataacga attcgctcat       360
     ccaaagtaac tccgtaggcc ttcaaatagt gtaaaaatga atgccgagct tgcggcagac       420
     cgcgcacaag tgataccaca gcctcgatat aggccgcgaa gtccttgctc atgccagaga       480
     gcctagcggc gcccccgaat gtctgtcgtt tgctagatgt gttgttgata tcttctgtct       540
     gcaatctcga ctttattgtg tcggctggat aaaagaggaa attgtagctg acaccggctg       600
     ctgctccggc caacatctgt tgataaagag ggagtgaccc agattcgacc tcagaggaaa       660
     aggttgtcga aggtgaataa tggtatgaac ggaaaagtgc tgacacccct tcgtaacccc       720
     caaaccacgc agcaccaccg cccgtctcac ggataagcgt acccagttgg ccgcgccaga       780
     accccaagac gccgtcctgg cggaaaacag agactataat cttgaggggt cccactcgtg       840
     cgctggaagg ctccgagggc acttgcatct tgcatttgat gagctcgatc ggtgtcaagg       900
     caagggaggt gatggatccg gatgcagcac cgctgaacac caaagcagtt aacggtaacg       960
     gctctgtcga ggaatagtac gaggcctgaa gtagctcttg aaccacacgg taactgaaga      1020
     acaagcagct gttctctaca gcagctcccg ccatcggagc gctgattccc cgatagagac      1080
     cccgaagacc ctctgcctgg aatgactgac ggaaacaatc taacggccca ttgtatcgga      1140
     gaggaaggtg atccggttgt gactgaagcc taaccttgac cgtgtcaaag ggatattcaa      1200
     tgaccttgcc tatcattcct gcagctgatc caaaaagaat atctttgaag gcctctagac      1260
     cttgattggg ggctagttca ggcagctcca ttgagatatc attgtgtatc gtcaacgcac      1320
     tttcggtagc cgccataggg atggatatgc tgagcgctta aagccaacgg tcgtccgagt      1380
     agaggaggaa aaagaaggaa ggaaggaagg aaggaaggaa ggaaggaaga gtagttggta      1440
     gattttatcg ggaaagcatc gtagaaagga tgggtgcaag gtgtttaaga gacagagtgt      1500
     gaggggcggt gtaccgacga ggggtttggc gttgccaatc cacgcgtgta cctgaagagc      1560
     tcagaactag aagcatcgct tgcaagctcg agcagtagaa aggccgaaat gcgggatatt      1620
     ttgagtggtg ggggcgcctt ttggcttcgg caggtggttc gttgcaggtt tgcgacaatt      1680
     cttttcagca gaagaccgga caatcctcgt ggacgagtca tcctcggggc ggctgggtgg      1740
     gcccggttca ccacttcccc cgagatccgt ttatctgatc gggctaagat aactttttcg      1800
     aaaaaaatcg agtcttggcc gtcaggtgaa gccaacttct cccttggcct cttctcagta      1860
     acacgtcctt agtcccttct agctctctca gagttttacc atgtcgtccg cagctccagc      1920
     accctcaacc catgcggcca aatcaatacg caagaatggt aggcgtccag cccccacttt      1980
     tctcgccaac ttttcctttt tcttcctggc taatcttccg ccgtctcgga cccgcaggta      2040
     aaaactggca tgacaacaag aagcccttca ggcccaacgg gggtttaacc tcgtacacaa      2100
     aaagagcggc tgcgcggaaa gaacaggagg ctattaagga gtatgaaaag gaattgagag      2160
     aggaaagaga agcagagaga caggtaagaa actcgcgaac cgcatggctc cattgcatat      2220
     gacgccttcc gcagagactg attcatgttc caggcgcaca tccaaagaat caaagaacgc      2280
     agagccgcga aggaagagaa ggagcgatat gagaaaatgg ccgagaagat gcatcgcaaa      2340
     cgggtcgagc gactgaagaa aagagaaaaa cgaaacaagc tcctcaactc ttgaacaatg      2400
     ttatcagtgt cagtgtgcat atccctacac atctgcttct gggtttgtcg ctgagttcga      2460
     ggagactccc ttatttgtgc ataggttcgg cgtcttagga gttagggctt caaggcctcg      2520
     gcgagcgaat gctttgtttc tcttgattgc ttacttcgga ttctttgctc gacatctttt      2580
     tacattttga catcggtcat taaccacata gtcgctcttg catctgatgg tcaattgcta      2640
     agaattgttt ttacgtcaca ctgtatcgca tttggctcct tgatgatgtt ataatcaagg      2700
     agaaaactac ccttaaaagt cttaattcct tggccctaag cctgccagca ggagtactcc      2760
     atcctttaaa atgacctcgg gtttgcttat ccgcagagac tgattatgga aaacacggaa      2820
     acctttgcag gccttctggg aagaaaaggg gaggaggggg gagggaagat aggaattc        2878
//

If you have problems or comments...

PBIL Back to PBIL home page