(data stored in ACNUC16935 zone)

EMBL: AF146190

ID   AF146190; SV 2; linear; mRNA; STD; FUN; 675 BP.
XX
AC   AF146190;
XX
DT   20-JUL-1999 (Rel. 60, Created)
DT   04-AUG-2000 (Rel. 64, Last updated, Version 2)
XX
DE   Emericella nidulans coiled-coil protein (cgrA) mRNA, complete cds.
XX
KW   .
XX
OS   Aspergillus nidulans
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-675
RA   Sun J., McFarland M., Moran L., Rhodes J.C., Askew D.S.;
RT   "Identification of an essential growth-regulated gene in S. cerevisiae and
RT   genomic organization of the ortholog in A. nidulans";
RL   Unpublished.
XX
RN   [2]
RP   1-675
RA   Sun J., Askew D.S.;
RT   ;
RL   Submitted (27-APR-1999) to the INSDC.
RL   Pathology, University of Cincinnati, 231 Bethesda Ave., Cincinnati, OH
RL   45267-0529, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-675
RA   Sun J., Askew D.S.;
RT   ;
RL   Submitted (03-AUG-2000) to the INSDC.
RL   Pathology, University of Cincinnati, 231 Bethesda Ave., Cincinnati, OH
RL   45267-0529, USA
XX
DR   MD5; 9ea73a79355259f7cce813f6202a13a6.
DR   StrainInfo; 598196; 0.
XX
CC   On Aug 3, 2000 this sequence version replaced gi:5532513.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..675
FT                   /organism="Aspergillus nidulans"
FT                   /chromosome="VII"
FT                   /strain="FGSC A4"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:162425"
FT   5'UTR           1..67
FT                   /gene="cgrA"
FT   CDS_pept        68..412
FT                   /codon_start=1
FT                   /gene="cgrA"
FT                   /product="coiled-coil protein"
FT                   /db_xref="GOA:Q9Y708"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y708"
FT                   /protein_id="AAD44764.2"
FT                   /translation="MSSAAPAPSTHAAKSIRKNGKNWHDNKKPFRPNGGLTSYTKRAAA
FT                   RKEQEAIKEYEKELREEREAERQAHIQRIKERRAAKEEKERYEKMAEKMHRKRVERLKK
FT                   REKRNKLLNS"
FT   3'UTR           413..675
FT                   /gene="cgrA"
XX
SQ   Sequence 675 BP; 195 A; 156 C; 162 G; 162 T; 0 other;
     aacttctccc ttggcctctt ctcagtaaca cgtccttagt cccttctagc tctctcagag        60
     ttttaccatg tcgtccgcag ctccagcacc ctcaacccat gcggccaaat caatacgcaa       120
     gaatggtaaa aactggcatg acaacaagaa gcccttcagg cccaacgggg gtttaacctc       180
     gtacacaaaa agagcggctg cgcggaaaga acaggaggct attaaggagt atgaaaagga       240
     attgagagag gaaagagaag cagagagaca ggcgcacatc caaagaatca aagaacgcag       300
     agccgcgaag gaagagaagg agcgatatga gaaaatggcc gagaagatgc atcgcaaacg       360
     ggtcgagcga ctgaagaaaa gagaaaaacg aaacaagctc ctcaactctt gaacaatgtt       420
     atcagtgtca gtgtgcatat ccctacacat ctgcttctgg gtttgtcgct gagttcgagg       480
     agactccctt atttgtgcat aggttcggcg tcttaggagt tagggcttca aggcctcggc       540
     gagcgaatgc tttgtttctc ttgattgctt acttcggatt ctttgctcga catcttttta       600
     cattttgaca tcggtcatta accacatagt cgctcttgca tctgatggtc aattgctaag       660
     aattgttttt acgtc                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page