(data stored in ACNUC23390 zone)

EMBL: AF153046

ID   AF153046; SV 1; linear; mRNA; STD; MUS; 2018 BP.
XX
AC   AF153046;
XX
DT   17-AUG-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus homeodomain protein HB9 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2018
RX   DOI; 10.1038/12674.
RX   PUBMED; 10471502.
RA   Harrison K.A., Thaler J., Pfaff S.L., Gu H., Kehrl J.H.;
RT   "Pancreas dorsal lobe agenesis and abnormal islets of Langerhans in
RT   Hlxb9-deficient mice";
RL   Nat Genet 23(1):71-75(1999).
XX
RN   [2]
RP   1-2018
RA   Kehrl J.H.;
RT   ;
RL   Submitted (18-MAY-1999) to the INSDC.
RL   NIAID, NIH, 10 Center Drive MSC 1876, Bethesda, MD 20892, USA
XX
DR   MD5; 332997eb9a4f35df9c48d4eff51ffad2.
DR   Ensembl-Gn; ENSMUSG00000001566; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029376; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029342; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029293; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029353; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029074; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029806; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028485; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029042; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029191; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029149; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029276; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029178; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029840; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028209; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028565; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000001608; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070603; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0070681; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070594; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070605; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070252; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071083; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070787; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070192; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070329; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070241; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070404; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070267; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071285; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070256; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069410; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2018
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7q36"
FT                   /strain="Swiss Webster/NIH"
FT                   /mol_type="mRNA"
FT                   /dev_stage="17 day embryo"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        196..1410
FT                   /codon_start=1
FT                   /product="homeodomain protein HB9"
FT                   /db_xref="GOA:Q9QZW9"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:109160"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZW9"
FT                   /protein_id="AAD49613.1"
FT                   /translation="MEKSKNFRIDALLAVDPPRAASTQSAPLALVTSLATTVSGPGRGG
FT                   SGGGGTSSGASRSCSPASSEATAAPGDRLRAESPSPPRLLAAHCALLPKPGFLGAGGGG
FT                   GAAGGPGTPHHHAHPGAAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGHPV
FT                   YSYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGASTFQLDQWLRASTAGMI
FT                   LPKMPDFSCQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLT
FT                   ETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGTGKGGSEEKTEEELMGPPVSG
FT                   DKASGRRLRDLRDSDPDEDEDDEEEDNFPYSNGAGAHAASSDCSSEDDSPPPRLGGPGH
FT                   QPLPQ"
XX
SQ   Sequence 2018 BP; 431 A; 590 C; 626 G; 371 T; 0 other;
     ccacgaggac cgcaaagagg aggcgcctgg acgatggtcg ctctcagctg agtttccggc        60
     tgcgacttta ttggcaaaaa atcgcagtaa caataccggc cccaaggctg gccaccgcca       120
     cgctcagtct ccgtaagccc gcacacgact gcatcgccca cccttggacc ctgattgtca       180
     gctccaatcg agccgatgga aaaatccaaa aatttccgca tcgacgccct gctggccgtg       240
     gatcccccgc gagccgcctc cacgcagagc gcgcctctgg ccttggtcac ttccctcgcg       300
     actacagtat ctggtcccgg ccgcggcggc agcggcggcg gggggaccag tagcggggcg       360
     agccgtagct gcagtcccgc atcctcggag gccactgcag cgcccggtga ccggctgaga       420
     gctgagagcc cgtcgccccc acgcttgctg gctgcacact gcgcgctgct gcccaagccc       480
     ggattcctgg gcgccggagg aggcggcggc gcggcgggtg ggccgggcac tccccaccac       540
     cacgcgcacc ctggtgcagc agccgccgcg gctgccgctg ccgctgccgc ggctgccggt       600
     ggcctggcac tggggctgca cccggggggc gcacagggcg gcgcgggcct ccctgcacag       660
     gcggctctct atggacaccc ggtctacagt tattcggcag cagctgcagc ggccgcgcta       720
     gctggccagc acccggcgct ttcctactca taccctcagg tgcagggcgc gcaccctgcg       780
     caccctgccg accccatcaa gctgggtgcc agcaccttcc aactggacca gtggctgcgc       840
     gcgtctactg cgggcatgat cctgcccaag atgccggact tcagctgtca ggcgcagtcg       900
     aacctcttgg ggaagtgccg aaggcctcgc acggccttca ccagccagca gctgttggag       960
     ctggaacacc agttcaagct caacaagtac ctgtctcgac ccaagcgttt tgaggtggct      1020
     acctcgctca tgctcaccga gactcaggtg aagatttggt tccagaaccg ccgaatgaaa      1080
     tggaaacgca gcaaaaaggc caaagagcag gctgcgcagg aggcggagaa gcagaagggc      1140
     ggcggcgggg gcaccggcaa aggcggcagt gaggagaaga cggaagagga gctgatgggg      1200
     cctccggttt cgggggacaa ggcaagcggc cgtcgcctgc gggacttgcg ggacagtgac      1260
     cctgatgagg acgaggatga tgaagaagag gacaacttcc cgtacagcaa tggtgccggt      1320
     gcccatgctg cctcatccga ctgctcatct gaggacgact cgcctcctcc aagactaggc      1380
     gggcctggac accaacctct gccccagtag ttgcctccag ggcggaagca gggatgcgaa      1440
     agatggctac ctggggggct gcggggcttg ggggagttta caatcccatc ctatggcctg      1500
     cagccaggct gacagcctct ccccgaacca tgcatccaag tgcaggctgg gctgcggatc      1560
     ctttttggga cctcgagggg acagcaagag agaatgagag aggagctcca atgtgagctt      1620
     ttcgttctta tacatttaat ttcgggtgat gttggccaga ggtatctggg agaacctacc      1680
     ctttctagga gtggctcctg cctgactctt ccttcgtcgg agaaaggaaa aaacagtgtt      1740
     aagtgaccta gaaacttgaa ccctcctttg gagacaacca ttctgctgaa aatttaaaac      1800
     agagggagga aaaaggtgtt atgcctatgt atgggggggg ggcggtagtg gagtgaggtg      1860
     ttatgtcatg agcattcaga ttgctgaaaa aaatctcaga atggtagtgt atttttgtat      1920
     attgtattta tatataaaga aagaaatgtc tacttatgca tgctaaatta ttatttagct      1980
     ttcccatccc ccagggtgga gatggaatgt aaaataaa                              2018
//

If you have problems or comments...

PBIL Back to PBIL home page