(data stored in ACNUC30567 zone)

EMBL: AF153350

ID   AF153350; SV 2; linear; mRNA; STD; MUS; 2917 BP.
XX
AC   AF153350;
XX
DT   26-MAY-2000 (Rel. 63, Created)
DT   02-JAN-2017 (Rel. 131, Last updated, Version 4)
XX
DE   Mus musculus metalloprotease disintegrin (Adam28) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2917
RX   PUBMED; 10794709.
RA   Howard L., Maciewicz R.A., Blobel C.P.;
RT   "Cloning and characterization of ADAM28: evidence for autocatalytic
RT   pro-domain removal and for cell surface localization of mature ADAM28";
RL   Biochem. J. 348(Pt 1):21-27(2000).
XX
RN   [2]
RP   1-2917
RA   Howard L., Blobel C.P.;
RT   ;
RL   Submitted (21-MAY-1999) to the INSDC.
RL   Cellular Biochemistry and Biophysics, Memorial Sloan-Kettering Cancer
RL   Center, RRL 337, Box 368, 1275 York Ave., New York, NY 10021, USA
XX
RN   [3]
RC   Sequence update by database staff to remove vector contamination
RP   1-2917
RA   Howard L., Blobel C.P.;
RT   ;
RL   Submitted (30-DEC-2016) to the INSDC.
RL   Cellular Biochemistry and Biophysics, Memorial Sloan-Kettering Cancer
RL   Center, RRL 337, Box 368, 1275 York Ave., New York, NY 10021, USA
XX
DR   MD5; af0a8976e9c89bde1364ad7d394e9d5e.
DR   Ensembl-Gn; ENSMUSG00000014725; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021512; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021471; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021447; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021477; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021254; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021916; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020771; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021221; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021344; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021323; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021419; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021352; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021939; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020515; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020824; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022642; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111072; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000224039; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0039973; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0039942; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0039897; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0039941; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0039682; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0040418; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0039688; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0039598; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0039743; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0039711; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0039834; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0039705; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0040453; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0039298; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0039074; mus_musculus_wsbeij.
XX
CC   On Dec 30, 2016 this sequence version replaced gi:8096673.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2917
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   gene            1..2917
FT                   /gene="Adam28"
FT   CDS_pept        37..2361
FT                   /codon_start=1
FT                   /gene="Adam28"
FT                   /product="metalloprotease disintegrin"
FT                   /note="MDC; ADAM28"
FT                   /db_xref="GOA:Q9JLN6"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034027"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="MGI:MGI:105988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JLN6"
FT                   /protein_id="AAF71993.1"
FT                   /translation="MQQWSLLVVSFLLSPVPVSAIKELPKAKKYEVVYPIRLHPLRKRE
FT                   TQEPEPKETFETELRYKMTVNGKVAVLYLKKNNKLLAPDYSETYYNSSGNKVTTSPQIM
FT                   DSCYYQGHIVNEKVSAASISTCQGLRGYISQGDEKYFIEPLSSENLDEQAHALFKDDSN
FT                   EDQEKSNCGVDDALWLQGLHQDVALPATRLIKLNDGMVQEPKKYIEYYVVLDNGEFKKY
FT                   NKNLAEIRKIVLEMANYINMLYNKLDAHVALVGVEIWTDGDKIKITPDANTTLENFSKW
FT                   RGNDLLKRKHHDIAQLISSTDFSGSTVGLAFMSSMCSPYHSVGIVQDHSNYHLRVAGTM
FT                   AHEMGHNLGMIHDYLSCKCPSEVCVMEQSLRFHMPTDFSSCSRVNYKQFLEEKLSHCLF
FT                   NSPLPSDIISTPVCGNQLLEMNEDCDCGTPKECTNKCCDARTCKIKAGFQCALGECCEK
FT                   CQLKKPGVVCRAAKDECDLPEVCDGKSSHCPGDRFRVNGSPCQNGHGYCLKGKCPTLQQ
FT                   QCMDMWGPGTKVANTSCYKQNEGGTKYGYCHVENGTHMPCKAKDAMCGKLFCEGGSGDL
FT                   PWKGLTISFLTCKLFDPEDTSQGVDMVANGTKCGTNKVCINAECVDMEKTYKSANCSSK
FT                   CKGHAVCDHELQCQCKEGWAPPDCENSATVFHFSIVVGVLFPLAVIFVVVAIVIQRQSA
FT                   RRKQRRVQRLPSTKDAKLHNQKCRPQKVKDVQPQEMSQMKKLHVSDLPSEEPEPPPDVL
FT                   ITKPNFPPPPIPVSLDPNAKV"
XX
SQ   Sequence 2917 BP; 907 A; 620 C; 689 G; 701 T; 0 other;
     gtgactggag gcagccactg ctcctgggat cgcagaatgc agcaatggag tcttctggta        60
     gtctctttcc ttctttctcc agttccagta agtgcaataa aagaactccc taaagccaag       120
     aaatatgaag tggtttatcc cataagactt catccattgc gtaaaagaga gacccaagag       180
     ccagagccaa aggaaacatt tgaaactgag ctaaggtaca aaatgacagt aaatggaaag       240
     gttgctgtgc tgtatctgaa gaagaacaac aagctccttg cgcctgacta ctcggaaaca       300
     tactataatt ccagtggaaa caaggtcacc acaagcccgc aaatcatgga tagctgttac       360
     taccaaggac acatcgtaaa tgagaaagtt tctgcagcca gcatcagcac ctgtcaagga       420
     ctacggggtt acatcagtca aggagatgaa aagtatttta tcgaaccttt gagctcggag       480
     aacttggatg aacaggcaca tgcactcttc aaggacgact ccaatgaaga ccaggagaag       540
     agcaactgtg gtgtggatga tgcgctatgg ctccaagggc tgcatcagga cgtggccctc       600
     cctgccacca ggttgattaa gttgaatgat gggatggttc aagaacctaa gaaatacata       660
     gaatattatg tggtcctgga taatggtgag tttaagaaat acaataaaaa tcttgctgaa       720
     atacgaaaga tagtgcttga gatggccaat tacatcaaca tgctttacaa taagcttgat       780
     gcccacgtgg ccttagttgg agtggaaatc tggaccgatg gggataaaat aaagataaca       840
     ccagatgcca acaccaccct ggaaaacttc tctaagtgga ggggaaatga tctgctaaaa       900
     cgaaagcatc atgatattgc ccagctaatc tcatcaacag acttttctgg atcaacagtg       960
     ggtctagcct tcatgtcgtc gatgtgttca ccttaccatt ctgttggcat tgttcaggac      1020
     cacagtaact accatcttcg agtcgcagga acaatggctc atgaaatggg tcacaatctt      1080
     ggcatgattc atgactactt gagctgcaag tgtccatctg aagtctgtgt aatggagcag      1140
     tcactaaggt tccatatgcc tacagacttc agctcctgca gtcgtgtcaa ttacaaacag      1200
     tttcttgaag aaaaattatc gcattgcctc tttaatagcc cattgccatc agatatcata      1260
     tccaccccag tctgtgggaa ccagttgttg gaaatgaatg aggactgtga ctgtggcaca      1320
     cccaaggagt gtactaacaa atgctgtgat gcaaggacct gtaaaattaa agcaggtttc      1380
     cagtgtgccc tgggggaatg ctgtgagaaa tgccaactta aaaaacctgg ggttgtgtgc      1440
     agagcagcaa aagatgagtg tgatctgcct gaagtgtgtg atggtaaatc cagccactgc      1500
     ccaggtgaca gattcagagt caatggctcc ccttgccaaa atgggcatgg ttactgcttg      1560
     aagggcaaat gtcccaccct gcagcagcag tgcatggaca tgtggggtcc aggaaccaag      1620
     gttgcaaata catcatgtta caagcagaat gaaggtggga caaagtacgg atactgtcat      1680
     gtggagaatg gcacacacat gccctgcaaa gcaaaagatg ccatgtgtgg gaaattgttc      1740
     tgtgaaggcg gatcaggtga tttgccctgg aaaggactta ccatatcttt cctgacatgt      1800
     aaattatttg atcctgaaga cacaagtcaa ggagtagaca tggtggccaa tggaaccaag      1860
     tgtggaacta acaaggtgtg cattaatgct gagtgtgtgg acatggagaa gacttacaag      1920
     tcagccaact gctcctcaaa gtgcaagggg cacgcagtgt gtgaccatga gcttcagtgt      1980
     cagtgcaagg aaggatgggc ccctcctgac tgcgagaatt cagccacagt cttccacttc      2040
     tccatcgtgg ttggcgtgct tttcccccta gcagtcatat ttgtggtggt tgctatagtg      2100
     atccagcgcc aaagtgccag aaggaagcag aggagagttc agaggctacc atccaccaag      2160
     gatgccaagc tacacaatca gaagtgtaga ccccaaaagg tgaaggatgt tcaaccccag      2220
     gagatgagtc agatgaaaaa gctccatgtg tctgatctgc cctctgaaga gccggagcct      2280
     ccacctgatg tcctaatcac aaagccaaat ttcccaccac caccaattcc tgtttccttg      2340
     gacccaaatg caaaagtctg aaacaacagt taatcagatg gtcagagtgg aagcctcgaa      2400
     attttggatg gaaaaagaga tgtgcttagt tctttattac tagcgctctt aaccctcagg      2460
     ggttagcatg ttctggtttg tgctgtattt tgaggagatt aaaagaaaga tacacttttg      2520
     aaaatctctg tgctaattta aatgatttcc tttccatatt cctaaggaca tggctaaagg      2580
     aatgtataaa ctgtaaaact ctagttgatt tcccccttta tttttactat gatcttgact      2640
     gactgctcaa atatattgaa gcccttaatg tcctcatttg gaggggattg atgtgccctc      2700
     taatgaaaat aaaacagagc ctggcagtgg tggtgcacgc ctttaatccc agcacttggg      2760
     aggcagaggc aggcggattt ctgagttcga ggccagccta gtctacagag tgagttccag      2820
     gacagccagg gctacacaga gaaaccctgt ctcaaaaaaa acaaaaacaa aacaaaataa      2880
     aacaaaacaa aacaaaaaca aaaaaaaaaa aaaaaaa                               2917
//

If you have problems or comments...

PBIL Back to PBIL home page