(data stored in ACNUC30567 zone)

EMBL: AF163291

ID   AF163291; SV 1; linear; mRNA; STD; MUS; 2638 BP.
XX
AC   AF163291;
XX
DT   03-MAY-2002 (Rel. 71, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus metalloproteinase-disintegrin TECADAM mRNA, truncated
DE   cytoplasmic domain, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2638
RX   DOI; 10.1016/S0378-1119(01)00871-X.
RX   PUBMED; 11867223.
RA   Haidl I.D., Huber G., Eichmann K.;
RT   "An ADAM family member with expression in thymic epithelial cells and
RT   related tissues";
RL   Gene 283(1-2):163-170(2002).
XX
RN   [2]
RP   1-2638
RA   Haidl I.D., Huber G., Eichmann K.;
RT   ;
RL   Submitted (29-JUN-1999) to the INSDC.
RL   Cellular Immunology, Max-Planck-Institute of Immunobiology, Stuebeweg 51,
RL   Freiburg D-79108, Germany
XX
DR   MD5; 2bca7f01cd7ef987c886cbbc4133da47.
DR   Ensembl-Gn; ENSMUSG00000014725; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021512; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021471; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021447; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021477; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021254; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021916; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020771; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021221; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021344; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021323; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021419; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021352; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021939; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020515; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020824; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022642; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111072; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000224039; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0039973; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0039942; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0039897; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0039941; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0039682; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0040418; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0039688; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0039598; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0039743; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0039711; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0039834; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0039705; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0040453; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0039298; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0039074; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2638
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_type="epithelium"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        153..2459
FT                   /codon_start=1
FT                   /product="metalloproteinase-disintegrin domain containing
FT                   protein TECADAM"
FT                   /note="truncated cytoplasmic domain"
FT                   /db_xref="GOA:Q9JLN6"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034027"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="MGI:MGI:105988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JLN6"
FT                   /protein_id="AAM21936.1"
FT                   /translation="MQQWSLLVVSFLLSPVPVSAIKELPKAKKYEVVYPIRLHPLRKRE
FT                   TQEPEPKETFETELRYKMTVNGKVAVLYLKKNNKLLAPDYSETYYNSSGNKVTTSPQIM
FT                   DSCYYQGHIVNEKVSAASISTCQGLRGYISQGDEKYFIEPLSSENLDEQAHALFKDDSN
FT                   EDQEKSNCGVDDALWLQGLHQDVALPATRLIKLNDGMVQEPKKYIEYYVVLDNGEFKKY
FT                   NKNLAEIRKIVLEMANYINMLYNKLDAHVALVGVEIWTDGDKIKITPDANTTLENFSKW
FT                   RGNDLLKRKHHDIAQLISSTDFSGSTVGLAFMSSMCSPYHSVGIVQDHSNYHLRVAGTM
FT                   AHEMGHNLGMIHDYLSCKCPSEVCVMEQSLRFHMPTDFSSCSRVNYKQFLEEKLSHCLF
FT                   NSPLPSDIISTPVCGNQLLEMNEDCDCGTPKECTNKCCDARTCKIKAGFQCALGECCEK
FT                   CQLKKPGVVCRAAKDECDLPEVCDGKSSHCPGDRFRVNGSPCQNGHGYCLKGKCPTLQQ
FT                   QCMDMWGPGTKVANTSCYKQNEGGTKYGYCHVENGTHMPCKAKDAMCGKLFCEGGSGDL
FT                   PWKGLTISFLTCKLFDPEDTSQGVDMVANGTKCGTNKVCINAECVDMEKTYKSANCSSK
FT                   CKGHAVCDHELQCQCKEGWAPPDCENSATVFHFSIVVGVLFPLAVIFVVVAIVIQRQSA
FT                   RRKQRRVQRLPSTKDAKLHNQKCRPQKVKDVQPQEMSQMKKLHVSDLPSEEPEPPPDVL
FT                   ITKPNFPPPPIPVSL"
FT   regulatory      2605..2610
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      2609..2614
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      2613..2618
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      2617..2622
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2638 BP; 786 A; 581 C; 633 G; 638 T; 0 other;
     agctccccag ttgtgcaaca ccttcggtaa acacttgctg aagcgtacac aatgaagcag        60
     ggagtttctt tctgtctccc ttaagaggag gttggagcag aagcaacctc acaggtgtga       120
     ctggaggcag ccactgctcc tgggatcgca gaatgcagca atggagtctt ctggtagtct       180
     ctttccttct ttctccagtt ccagtaagtg caataaaaga actccctaaa gccaagaaat       240
     atgaagtggt ttatcccata agacttcatc cattgcgtaa aagagagacc caagagccag       300
     agccaaagga aacatttgaa actgagctaa ggtacaaaat gacagtaaat ggaaaggttg       360
     ctgtgctgta tctgaagaag aacaacaagc tccttgcgcc tgactactcg gaaacatact       420
     ataattccag tggaaacaag gtcaccacaa gcccgcaaat catggatagc tgttactacc       480
     aaggacacat cgtaaatgag aaagtttctg cagccagcat cagcacctgt caaggactac       540
     ggggttacat cagtcaagga gatgaaaagt attttatcga acctttgagc tcggagaact       600
     tggatgaaca ggcacatgca ctcttcaagg acgactccaa tgaagaccag gagaagagca       660
     actgtggtgt ggatgatgcg ctatggctcc aagggctgca tcaggacgtg gccctccctg       720
     ccaccaggtt gattaagttg aatgatggga tggttcaaga acctaagaaa tacatagaat       780
     attatgtggt cctggataat ggtgagttta agaaatacaa taaaaatctt gctgaaatac       840
     gaaagatagt gcttgagatg gccaattaca tcaacatgct ttacaataag cttgatgccc       900
     acgtggcctt agttggagtg gaaatctgga ccgatgggga taaaataaag ataacaccag       960
     atgccaacac caccctggaa aacttctcta agtggagggg aaatgatctg ctaaaacgaa      1020
     agcatcatga tattgcccag ctaatctcat caacagactt ttctggatca acagtgggtc      1080
     tagccttcat gtcgtcgatg tgttcacctt accattctgt tggcattgtt caggaccaca      1140
     gtaactacca tcttcgagtc gcaggaacaa tggctcatga aatgggtcac aatcttggca      1200
     tgattcatga ctacttgagc tgcaagtgtc catctgaagt ctgtgtaatg gagcagtcac      1260
     taaggttcca tatgcctaca gacttcagct cctgcagtcg tgtcaattac aaacagtttc      1320
     ttgaagaaaa attatcgcat tgcctcttta atagcccatt gccatcagat atcatatcca      1380
     ccccagtctg tgggaaccag ttgttggaaa tgaatgagga ctgtgactgt ggcacaccca      1440
     aggagtgtac taacaaatgc tgtgatgcaa ggacctgtaa aattaaagca ggtttccagt      1500
     gtgccctggg ggaatgctgt gagaaatgcc aacttaaaaa acctggggtt gtgtgcagag      1560
     cagcaaaaga tgagtgtgat ctgcctgaag tgtgtgatgg taaatccagc cactgcccag      1620
     gtgacagatt cagagtcaat ggctcccctt gccaaaatgg gcatggttac tgcttgaagg      1680
     gcaaatgtcc caccctgcag cagcagtgca tggacatgtg gggtccagga accaaggttg      1740
     caaatacatc atgttacaag cagaatgaag gtgggacaaa gtacggatac tgtcatgtgg      1800
     agaatggcac acacatgccc tgcaaagcaa aagatgccat gtgtgggaaa ttgttctgtg      1860
     aaggcggatc aggtgatttg ccctggaaag gacttaccat atctttcctg acatgtaaat      1920
     tatttgatcc tgaagacaca agtcaaggag tagacatggt ggccaatgga accaagtgtg      1980
     gaactaacaa ggtgtgcatt aatgctgagt gtgtggacat ggagaagact tacaagtcag      2040
     ccaactgctc ctcaaagtgc aaggggcacg cagtgtgtga ccatgagctt cagtgtcagt      2100
     gcaaggaagg atgggcccct cctgactgcg agaattcagc cacagtcttc cacttctcca      2160
     tcgtggttgg cgtgcttttc cccctagcag tcatatttgt ggtggttgct atagtgatcc      2220
     agcgccaaag tgccagaagg aagcagagga gagttcagag gctaccatcc accaaggatg      2280
     ccaagctaca caatcagaag tgtagacccc aaaaggtgaa ggatgttcaa ccccaggaga      2340
     tgagtcagat gaaaaagctc catgtgtctg atctgccctc tgaagagccg gagcctccac      2400
     ctgatgtcct aatcacaaag ccaaatttcc caccaccacc aattcctgtt tccttgtaag      2460
     tatcagatgc tcacaatcca cagtttcgtt gtcagtgctc cctaggctaa cctaatgtca      2520
     tcctagcatg tttgttctgg ggaacctgga aaggcaaggc ctccttctgt actgatttcc      2580
     catggccact gaatctttgc tgtaaataaa taaataaata aagttatttt ataaattt        2638
//

If you have problems or comments...

PBIL Back to PBIL home page