(data stored in ACNUC30567 zone)

EMBL: AF163293

ID   AF163293; SV 1; linear; mRNA; STD; MUS; 2946 BP.
XX
AC   AF163293;
XX
DT   02-MAY-2004 (Rel. 79, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus metalloproteinase-disintegrin TECADAM mRNA, soluble form,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2946
RA   Haidl I.D., Huber G., Eichmann K.;
RT   "Isolation of a Novel Thymic Epithelial Cell cDNA Encoding a Protein
RT   Containing Metalloproteinase and Disintegrin Domains";
RL   Unpublished.
XX
RN   [2]
RP   1-2946
RA   Haidl I.D., Huber G., Eichmann K.;
RT   ;
RL   Submitted (29-JUN-1999) to the INSDC.
RL   Cellular Immunology, Max-Planck-Institute of Immunobiology, Stuebeweg 51,
RL   Freiburg D-79108, Germany
XX
DR   MD5; 38e599a27048178f372a659baccffe55.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2946
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        153..2108
FT                   /codon_start=1
FT                   /product="metalloproteinase-disintegrin domain containing
FT                   protein TECADAM"
FT                   /note="soluble form"
FT                   /db_xref="GOA:Q71U12"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034027"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="MGI:MGI:105988"
FT                   /db_xref="UniProtKB/TrEMBL:Q71U12"
FT                   /protein_id="AAQ07988.1"
FT                   /translation="MQQWSLLVVSFLLSPVPVSAIKELPKAKKYEVVYPIRLHPLRKRE
FT                   TQEPEPKETFETELRYKMTVNGKVAVLYLKKNNKLLAPDYSETYYNSSGNKVTTSPQIM
FT                   DSCYYQGHIVNEKVSAASISTCQGLRGYISQGDEKYFIEPLSSENLDEQAHALFKDDSN
FT                   EDQEKSNCGVDDALWLQGLHQDVALPATRLIKLNDGMVQEPKKYIEYYVVLDNGEFKKY
FT                   NKNLAEIRKIVLEMANYINMLYNKLDAHVALVGVEIWTDGDKIKITPDANTTLENFSKW
FT                   RGNDLLKRKHHDIAQLISSTDFSGSTVGLAFMSSMCSPYHSVGIVQDHSNYHLRVAGTM
FT                   AHEMGHNLGMIHDYLSCKCPSEVCVMEQSLRFHMPTDFSSCSRVNYKQFLEEKLSHCLF
FT                   NSPLPSDIISTPVCGNQLLEMNEDCDCGTPKECTNKCCHARTCKIKAGFQCALGECCEK
FT                   CQLKKPGVVCRAAKDECDLPEVCDGKSSHCPGDRFRVNGSPCQNGHGYCLKGKCPTLQQ
FT                   QCMDMWGPGTKVANTSCYKQNEGGTKYGYCHVENGTHMPCKAKDAMCGKLFCEGGSGDL
FT                   PWKGLTISFLTCKLFDPEDTSQGVDMVANGTKCGTNKVCINAECVDMEKTYKSANCSSK
FT                   CKGHATSPSWLACFSP"
FT   regulatory      2535..2540
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      2913..2918
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2946 BP; 910 A; 628 C; 697 G; 711 T; 0 other;
     agcttcccca gttgtgcaac accttggtaa acacttgctg aagcgtacac aatgaagcag        60
     ggagtttctt tctgtctccc ttaagaggag gttggagcag aagcaacctc acaggtgtga       120
     ctggaggcag ccactgctcc tgggatcgca gaatgcagca atggagtctt ctggtagtct       180
     ctttccttct ttctccagtt ccagtaagtg caataaaaga actccctaaa gccaagaaat       240
     atgaagtggt ttatcccata agacttcatc cattgcgtaa aagagagacc caagagccag       300
     agccaaagga aacatttgaa actgagctaa ggtacaaaat gacagtaaat ggaaaggttg       360
     ctgtgctgta tctgaagaag aacaacaagc tccttgcgcc tgactactcg gaaacatact       420
     ataattccag tggaaacaag gtcaccacaa gcccgcaaat catggatagc tgttactacc       480
     aaggacacat cgtaaatgag aaagtttctg cagccagcat cagcacctgt caaggactac       540
     ggggttacat cagtcaagga gatgaaaagt attttatcga acctttgagc tcggagaact       600
     tggatgaaca ggcacatgca ctcttcaagg acgactccaa tgaagaccag gagaagagca       660
     actgtggtgt ggatgatgcg ctatggctcc aagggctgca tcaggacgtg gccctccctg       720
     ccaccaggtt gattaagttg aatgatggga tggttcaaga acctaagaaa tacatagaat       780
     attatgtggt cctggataat ggtgagttta agaaatacaa taaaaatctt gctgaaatac       840
     gaaagatagt gcttgagatg gccaattaca tcaacatgct ttacaataag cttgatgccc       900
     acgtggcctt agttggagtg gaaatctgga ccgatgggga taaaataaag ataacaccag       960
     atgccaacac caccctggaa aacttctcta agtggagggg aaatgatctg ctaaaacgaa      1020
     agcatcatga tattgcccag ctaatctcat caacagactt ttctggatca acagtgggtc      1080
     tagccttcat gtcgtcgatg tgttcacctt accattctgt tggcattgtt caggaccaca      1140
     gtaactacca tcttcgagtc gcaggaacaa tggctcatga aatgggtcac aatcttggca      1200
     tgattcatga ctacttgagc tgcaagtgtc catctgaagt ctgtgtaatg gagcagtcac      1260
     taaggttcca tatgcctaca gacttcagct cctgcagtcg tgtcaattac aaacagtttc      1320
     ttgaagaaaa attatcgcat tgcctcttta atagcccatt gccatcagat atcatatcca      1380
     ccccagtctg tgggaaccag ttgttggaaa tgaatgagga ctgtgactgt ggcacaccca      1440
     aggagtgtac taacaaatgc tgtcatgcaa ggacctgtaa aattaaagca ggtttccagt      1500
     gtgccctggg ggaatgctgt gagaaatgcc aacttaaaaa acctggggtt gtgtgcagag      1560
     cagcaaaaga tgagtgtgat ctgcctgaag tgtgtgatgg taaatccagc cactgcccag      1620
     gtgacagatt cagagtcaat ggctcccctt gccaaaatgg gcatggttac tgcttgaagg      1680
     gcaaatgtcc caccctgcag cagcagtgca tggacatgtg gggtccagga accaaggttg      1740
     caaatacatc atgttacaag cagaatgaag gtgggacaaa gtacggatac tgtcatgtgg      1800
     agaatggcac acacatgccc tgcaaagcaa aagatgccat gtgtgggaaa ttgttctgtg      1860
     aaggcggatc aggtgatttg ccctggaaag gacttaccat atctttcctg acatgtaaat      1920
     tatttgatcc tgaagacaca agtcaaggag tagacatggt ggccaatgga accaagtgtg      1980
     gaactaacaa ggtgtgcatt aatgctgagt gtgtggacat ggagaagact tacaagtcag      2040
     ccaactgctc ctcaaagtgc aaggggcacg caacttctcc atcgtggttg gcgtgctttt      2100
     ccccctagca gtcatatttg tggtggttgc tatagtgatc cagcgccaaa gtgccagaag      2160
     gaagcagagg agagttcaga ggctaccatc caccaaggat gccaagctac acaatcagaa      2220
     gtgtagaccc caaaaggtga aggatgttca accccaggag atgagtcaga tgaaaaagct      2280
     ccatgtgtct gatctgccct ctgaagagcc ggagcctcca cctgatgtcc taatcacaaa      2340
     gccaaatttc ccaccaccac caattcctgt ttccttggac ccaaatgcaa aagtctgaaa      2400
     caacagttaa tcagatggtc agagtggaag cctcgaaatt ttggatggaa aaagagatgt      2460
     gcttagttct ttattactag cgctcttaac cctcaggggt tagcatgttc tggtttgtgc      2520
     tgtattttga ggagattaaa agaaagatac acttttgaaa atctctgtgc taatttaaat      2580
     gatttccttt ccatattcct aaggacatgg ctaaaggaat gtataaactg taaaactcta      2640
     gttgatttcc ccctttattt ttactatgat cttgactgac tgctcaaata tattgaagcc      2700
     cttaatgtcc tcatttggag gggattgatg tgccctctaa tgaaaataaa acagagcctg      2760
     gcagtggtgg tgcacgcctt taatcccagc acttgggagg cagaggcggg cggatttctg      2820
     agttcgaggc cagcctagtc tacagagtga gttccaggac agccagggct acacagagaa      2880
     accctgtctc aaaaaaaaca aaaacaaaac aaaataaaac aaaacaaaac aaaaacaaaa      2940
     gaaaag                                                                 2946
//

If you have problems or comments...

PBIL Back to PBIL home page