(data stored in ACNUC24361 zone)

EMBL: AF170025

ID   AF170025; SV 1; linear; mRNA; STD; HUM; 4159 BP.
XX
AC   AF170025;
XX
DT   14-JAN-2000 (Rel. 62, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens zinc finger protein ZFP-95 (ZFP95) mRNA, alternatively
DE   spliced, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4159
RX   DOI; 10.1006/geno.1999.5981.
RX   PUBMED; 10585779.
RA   Dreyer S.D., Zheng Q., Zabel B., Winterpacht A., Lee B.;
RT   "Isolation, characterization, and mapping of a zinc finger gene, ZFP95,
RT   containing both a SCAN box and an alternatively spliced KRAB A domain";
RL   Genomics 62(1):119-122(1999).
XX
RN   [2]
RP   1-4159
RA   Dreyer S.D., Zheng Q., Zabel B., Winterpacht A., Lee B.;
RT   ;
RL   Submitted (19-JUL-1999) to the INSDC.
RL   Molecular and Human Genetics, Baylor College of Medicine, One Baylor Plaza,
RL   Rm E630, Houston, TX 77030, USA
XX
DR   MD5; 6c99985912a9a86bc96ab0f0a93833b5.
DR   Ensembl-Gn; ENSG00000196652; homo_sapiens.
DR   Ensembl-Tr; ENST00000326775; homo_sapiens.
DR   Ensembl-Tr; ENST00000394170; homo_sapiens.
DR   Ensembl-Tr; ENST00000451158; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4159
FT                   /organism="Homo sapiens"
FT                   /chromosome="7"
FT                   /map="7q22"
FT                   /mol_type="mRNA"
FT                   /note="between D7S651 and WI 5853"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        105..2624
FT                   /codon_start=1
FT                   /gene="ZFP95"
FT                   /product="zinc finger protein ZFP-95"
FT                   /note="KIAA1015; SCAN box motif, KRAB A domain, alternative
FT                   splicing for exons 4 and 5"
FT                   /db_xref="GOA:Q9Y2L8"
FT                   /db_xref="H-InvDB:HIT000072367_03.4"
FT                   /db_xref="HGNC:HGNC:12867"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036051"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="PDB:2EM5"
FT                   /db_xref="PDB:2EMM"
FT                   /db_xref="PDB:2EMZ"
FT                   /db_xref="PDB:2EN3"
FT                   /db_xref="PDB:2EOM"
FT                   /db_xref="PDB:2EON"
FT                   /db_xref="PDB:2EOO"
FT                   /db_xref="PDB:2YSO"
FT                   /db_xref="PDB:2YTG"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y2L8"
FT                   /protein_id="AAF24219.1"
FT                   /translation="MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPT
FT                   FETFYQRFRHFQYHEASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPE
FT                   EFQPWVREHHPESGEEAVAVIENIQRELEERRQQIVACPDVLPRKMATPGAVQESCSPH
FT                   PLTVDTQPEQAPQKPRLLEENALPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEVAD
FT                   VAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDNMELIVKQISDDSESHWV
FT                   APEHTERSVPQDPDFAEVSDLKGMVQRWQVNPTVGKSRQNPSQKRDLDAITDISPKQST
FT                   HGERGHRCSDCGKFFLQASNFIQHRRIHTGEKPFKCGECGKSYNQRVHLTQHQRVHTGE
FT                   KPYKCQVCGKAFRVSSHLVQHHSVHSGERPYGCNECGKNFGRHSHLIEHLKRHFREKSQ
FT                   RCSDKRSKNTKLSVKKKISEYSEADMELSGKTQRNVSQVQDFGEGCEFQGKLDRKQGIP
FT                   MKEILGQPSSKRMNYSEVPYVHKKSSTGERPHKCNECGKSFIQSAHLIQHQRIHTGEKP
FT                   FRCEECGKSYNQRVHLTQHQRVHTGEKPYTCPLCGKAFRVRSHLVQHQSVHSGERPFKC
FT                   NECGKGFGRRSHLAGHLRLHSREKSHQCRECGEIFFQYVSLIEHQVLHMGQKNEKNGIC
FT                   EEAYSWNLTVIEDKKIELQEQPYQCDICGKAFGYSSDLIQHYRTHTAEKPYQCDICREN
FT                   VGQCSHTKQHQKIYSSTKSHQCHECGRGFTLKSHLNQHQRIHTGEKPFQCKECGMNFSW
FT                   SCSLFKHLRSHERTDPINTLSVEGSLL"
XX
SQ   Sequence 4159 BP; 1176 A; 960 C; 1036 G; 985 T; 2 other;
     cgggcgactc gcgggtgtga cgttgaagat gtcggccttc tgagccgact gcggtggtca        60
     agagtgtaac acagccagcc tcgaagactt ccctctgagt tggaatgata atgaccgaat       120
     cccgagaagt tatagactta gaccccccag ctgagacttc ccaggagcag gaagaccttt       180
     tcatagtgaa ggtggaagaa gaagactgca cctggatgca ggagtacaac ccgccaacgt       240
     ttgagacttt ttaccagcgc ttcaggcact tccagtacca tgaggcttca ggaccccggg       300
     aggctctcag ccaactccgg gtgctctgct gtgagtggct gaggcccgag ctgcacacga       360
     aggagcagat cctggagctg ctggtgctgg agcagttcct gaccatcctg cctgaagagt       420
     tccagccctg ggtgagggaa catcaccctg aaagtggaga agaggcggtg gccgtgatag       480
     aaaatataca gcgagaactt gaggaacgca gacagcagat tgttgcctgc cctgatgtgc       540
     ttcctcggaa gatggcaaca cctggagcag tgcaggagtc ctgcagcccc catcccctga       600
     ccgtggacac ccagcctgag caagcgccac agaagcctcg tctcctggag gaaaatgccc       660
     ttcctgttct ccaagttcct tcccttcccc tgaaggacag ccaggagctg acagcttcac       720
     ttctctcaac tgggtcccag aagttggtga aaattgaaga ggtggctgat gtggctgtat       780
     ccttcatcct ggaggaatgg gggcatttgg accagtccca gaagtccctt tatagggatg       840
     acaggaagga gaactatggg agtattactt ccatgggtta tgagtccagg gacaatatgg       900
     agctcatagt gaagcagatt tctgatgact ctgaatcaca ctgggtggcg ccagaacaca       960
     ccgaaaggag cgttcctcag gatccagact ttgcagaagt cagtgacctt aaaggcatgg      1020
     tacaaaggtg gcaggtcaac cccactgtgg ggaaatcaag gcagaatcct tcccagaaaa      1080
     gggatctgga tgcaatcaca gacatcagcc ctaagcaaag cacacatggc gagagagggc      1140
     acagatgcag cgattgtggc aaattcttcc tccaagcctc aaactttatt cagcatcggc      1200
     gcatccacac tggagaaaaa ccgtttaagt gcggagaatg tgggaagagc tacaatcagc      1260
     gggtgcacct cacccagcac cagcgcgtcc acacagggga gaaaccctac aaatgtcagg      1320
     tgtgcggaaa ggctttccgg gtgagttccc acctggttca gcaccacagt gtccacagcg      1380
     gagagaggcc ctatggctgc aatgagtgtg ggaagaactt cggtcgccat tcgcatctga      1440
     tcgaacacct aaaacgccac ttcagggaga aatcccagag atgcagtgac aaaagaagta      1500
     agaacacaaa attaagtgtt aagaagaaaa tttcagaata ttcagaagca gacatggaac      1560
     tatctggaaa aacccaaaga aatgtttctc aagttcaaga ttttggagaa ggctgtgagt      1620
     ttcaaggcaa gctggataga aagcagggaa ttcccatgaa agagatacta ggacaaccat      1680
     cttcaaagag gatgaactac agtgaagtcc catatgtcca caaaaaatcc tccactggag      1740
     agagaccaca taaatgtaac gagtgtggga aaagcttcat tcagagtgca catcttattc      1800
     aacatcaaag aatacacact ggggagaaac cattcaggtg tgaggaatgt gggaaaagct      1860
     acaaccaacg cgtgcaccta actcagcatc agcgcgtcca cacaggtgag aagccctaca      1920
     cctgtccctt atgtgggaaa gccttcagag tgaggtccca ccttgttcag catcagagcg      1980
     tgcacagtgg ggagagaccc ttcaagtgta acgaatgtgg gaaaggcttt gggaggcgtt      2040
     cccacctggc tggacatctt cgactccact cccgagagaa atcccatcag tgtcgtgaat      2100
     gtggggaaat cttttttcag tacgttagcc taattgaaca tcaggtgctc cacatgggtc      2160
     agaaaaatga aaaaaatggc atctgtgagg aagcatatag ttggaacttg acagtgattg      2220
     aagacaagaa gattgagtta caagagcagc cttatcagtg tgatatctgt ggaaaagcct      2280
     ttggttatag ctcagacctc attcagcatt acagaactca tacagcagag aagccctatc      2340
     aatgtgatat atgtagagaa aatgttggcc agtgttccca caccaaacaa catcaaaaaa      2400
     tctactccag cacaaaatcc catcaatgtc atgaatgtgg cagaggcttc actctgaagt      2460
     cacatcttaa tcaacatcag agaatccata ctggtgagaa accttttcaa tgtaaagaat      2520
     gtggaatgaa tttcagctgg agttgtagcc tctttaaaca cctgagaagc catgagagga      2580
     cagatcccat aaatacctta agtgtagagg ggtctctgtt gtagaatagc tcttaatttt      2640
     agagaaacct tcctggaggg aaaccatact cctataatga gcaaagtaac aacttcaagc      2700
     atttttccag cgttaccatc aaactcacaa ataggttgaa atcctttagt tataactcag      2760
     cctttaggaa caccggagaa cccacaataa tagaaatctt ttcgtgttcc ccattgagaa      2820
     atgctttagt tagcatcttc atgcttggaa atctagacaa gaagagaatc catggatgga      2880
     catggtcgag gaattcggaa agcctgcagt tgacattcag tcttcacttg aaactcaaaa      2940
     ctgacactag gaacagcttc atgagttcag tagaagtaag ctttatttgt agcttctgcc      3000
     ttgtttgacg gcgtatctat tcagggaagc gcacagtaaa agaattcctt agcatgatgt      3060
     ctgttttggt acctcagcaa tgaacctttt ctagaaatta ttattccaac cactagaata      3120
     ccctagtcac tattcccact ttgagcatta acccctttga aaagaaatgg acttaaagta      3180
     tctctgtttt ggcaaaattc aggttcaggg gctggatggt atgtgtttct gctgccttat      3240
     tcaatccacc acttctctgt gaaacactct accttgtttt tggtttgatt ctactgatgt      3300
     cagggtttag ccggtagaag gagtagttca gtttgtcaat tcaggagaac ctgtactggt      3360
     cagtcacatc ttacggcgaa gggagaggga ccttagggga gcagagaaga cagccaaagt      3420
     tgtggactgt ttgatcttgt attacccaca ggaatgaggg cagctaaacc catagaagga      3480
     gttggaccaa ggcgaattac gagtcctggt cccagcagta tgtgtgctga cttctgggtg      3540
     ccccagaaat agacctctcc tgtagagtgg tgatatacag aatgagtttc agtttgcatt      3600
     gcagctggga ttgaaagtaa tcagtcatga gcaggcaggc aggaggtcct gttagccctg      3660
     ccttccagga aggttggggt gggagttttg agtgggaaag aggatgacat gtgtgagaga      3720
     gttctgagcc tgtttgctag ggagagtgag tgagtgctct tgggctctgc tcaggccgtt      3780
     tctgctgact tgcctggctt acaataaatg cccaataaat atttgttgac catatgtgtt      3840
     gtacactgtg gtgccctgtc cagtcccctc taccaagctg agacccccat ccccagctgc      3900
     tctgagtttg ggctgcaagt gctcacagct tttgttctcc agaaactgga gaattgccct      3960
     caggagatga gagccatctc acctcaccca ggagtcactt cctctntaca ccccaacacc      4020
     tggttcattt gattaaagcg gagaaaactc cagggtgcta tgactgctct ggcacccttg      4080
     gatcaggcca agctagactt tttctgagcc ttcatccgng ctaagctctc tcccttgtct      4140
     atcctgtttc attcccccc                                                   4159
//

If you have problems or comments...

PBIL Back to PBIL home page