(data stored in ACNUC21429 zone)

EMBL: AF176069

ID   AF176069; SV 3; linear; mRNA; STD; HUM; 1770 BP.
XX
AC   AF176069;
XX
DT   17-AUG-1999 (Rel. 60, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens ubiquilin mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1770
RX   DOI; 10.1083/jcb.151.4.847.
RX   PUBMED; 11076969.
RA   Mah A.L., Perry G., Smith M.A., Monteiro M.J.;
RT   "Identification of ubiquilin, a novel presenilin interactor that increases
RT   presenilin protein accumulation";
RL   J. Cell Biol. 151(4):847-862(2000).
XX
RN   [2]
RP   1-1770
RA   Mah A.L., Monteiro M.J.;
RT   ;
RL   Submitted (05-AUG-1999) to the INSDC.
RL   MBC, University of Maryland, 725 West Lombard Street, Baltimore, MD 21201,
RL   USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1770
RA   Mah A.L., Monteiro M.J.;
RT   ;
RL   Submitted (22-JAN-2002) to the INSDC.
RL   MBC, University of Maryland, 725 West Lombard Street, Baltimore, MD 21201,
RL   USA
XX
DR   MD5; 203f131e57acb262784f85c5ea60fd2a.
DR   Ensembl-Gn; ENSG00000135018; homo_sapiens.
DR   Ensembl-Tr; ENST00000257468; homo_sapiens.
DR   Ensembl-Tr; ENST00000376395; homo_sapiens.
DR   EuropePMC; PMC2169435; 11076969.
XX
CC   On Jan 22, 2002 this sequence version replaced gi:18254508.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1770
FT                   /organism="Homo sapiens"
FT                   /chromosome="9"
FT                   /map="9q22"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..1770
FT                   /codon_start=1
FT                   /product="ubiquilin"
FT                   /note="similar to yeast DSK2"
FT                   /db_xref="GOA:Q9UMX0"
FT                   /db_xref="H-InvDB:HIT000072641.14"
FT                   /db_xref="HGNC:HGNC:12508"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR028799"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:2JY5"
FT                   /db_xref="PDB:2JY6"
FT                   /db_xref="PDB:2KLC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UMX0"
FT                   /protein_id="AAD49751.3"
FT                   /translation="MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPK
FT                   EKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHL
FT                   VIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGL
FT                   NTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRN
FT                   PEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQE
FT                   PMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTAS
FT                   TVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPY
FT                   MRSMMQSLSQNPDLAAQMMLNNPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPR
FT                   AMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGT
FT                   TEPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDI
FT                   NAAIERLLGSQPS"
XX
SQ   Sequence 1770 BP; 529 A; 431 C; 406 G; 404 T; 0 other;
     atggccgaga gtggtgaaag cggcggtcct ccgggctccc aggatagcgc cgccggagcc        60
     gaaggtgctg gcgcccccgc ggccgctgcc tccgcggagc ccaaaatcat gaaagtcacc       120
     gtgaagaccc cgaaggaaaa ggaggaattc gccgtgcccg agaatagctc cgtccagcag       180
     tttaaggaag aaatctctaa acgttttaaa tcacatactg accaacttgt gttgatattt       240
     gctggaaaaa ttttgaaaga tcaagatacc ttgagtcagc atggaattca tgatggactt       300
     actgttcacc ttgtcattaa aacacaaaac aggcctcagg atcattcagc tcagcaaaca       360
     aatacagctg gaagcaatgt tactacatca tcaactccta atagtaactc tacatctggt       420
     tctgctacta gcaacccttt tggtttaggt ggccttgggg gacttgcagg tctgagtagc       480
     ttgggtttga atactaccaa cttctctgaa ctacagagtc agatgcagcg acaacttttg       540
     tctaaccctg aaatgatggt ccagatcatg gaaaatccct ttgttcagag catgctctca       600
     aatcctgacc tgatgagaca gttaattatg gccaatccac aaatgcagca gttgatacag       660
     agaaatccag aaattagtca tatgttgaat aatccagata taatgagaca aacgttggaa       720
     cttgccagga atccagcaat gatgcaggag atgatgagga accaggaccg agctttgagc       780
     aacctagaaa gcatcccagg gggatataat gctttaaggc gcatgtacac agatattcag       840
     gaaccaatgc tgagtgctgc acaagagcag tttggtggta atccatttgc ttccttggtg       900
     agcaatacat cctctggtga aggtagtcaa ccttcccgta cagaaaatag agatccacta       960
     cccaatccat gggctccaca gacttcccag agttcatcag cttccagcgg cactgccagc      1020
     actgtgggtg gcactactgg tagtactgcc agtggcactt ctgggcagag tactactgcg      1080
     ccaaatttgg tgcctggagt aggagctagt atgttcaaca caccaggaat gcagagcttg      1140
     ttgcaacaaa taactgaaaa cccacaactt atgcaaaaca tgttgtctgc cccctacatg      1200
     agaagcatga tgcagtcact aagccagaat cctgaccttg ctgcacagat gatgctgaat      1260
     aatcccctat ttgctggaaa tcctcagctt caagaacaaa tgagacaaca gctcccaact      1320
     ttcctccaac aaatgcagaa tcctgataca ctatcagcaa tgtcaaaccc tagagcaatg      1380
     caggccttgt tacagattca gcagggttta cagacattag caacggaagc cccgggcctc      1440
     atcccagggt ttactcctgg cttgggggca ttaggaagca ctggaggctc ttcgggaact      1500
     aatggatcta acgccacacc tagtgaaaac acaagtccca cagcaggaac cactgaacct      1560
     ggacatcagc agtttattca gcagatgctg caggctcttg ctggagtaaa tcctcagcta      1620
     cagaatccag aagtcagatt tcagcaacaa ctggaacaac tcagtgcaat gggatttttg      1680
     aaccgtgaag caaacttgca agctctaata gcaacaggag gtgatatcaa tgcagctatt      1740
     gaaaggttac tgggctccca gccatcatag                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page