(data stored in ACNUC7820 zone)

EMBL: AF179731

ID   AF179731; SV 1; linear; genomic DNA; STD; MAM; 487 BP.
XX
AC   AF179731;
XX
DT   14-MAR-2000 (Rel. 63, Created)
DT   14-MAR-2000 (Rel. 63, Last updated, Version 1)
XX
DE   Pan troglodytes olfactory receptor (PTR206) gene, partial cds.
XX
KW   .
XX
OS   Pan troglodytes (chimpanzee)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Pan.
XX
RN   [1]
RP   1-487
RX   DOI; 10.1073/pnas.040580197.
RX   PUBMED; 10706615.
RA   Rouquier S., Blancher A., Giorgi D.;
RT   "The olfactory receptor gene repertoire in primates and mouse: evidence for
RT   reduction of the functional fraction in primates";
RL   Proc. Natl. Acad. Sci. U.S.A. 97(6):2870-2874(2000).
XX
RN   [2]
RP   1-487
RA   Giorgi D.G., Rouquier S.P.;
RT   ;
RL   Submitted (24-AUG-1999) to the INSDC.
RL   Institut de Genetique Humaine, CNRS, UPR 1142, rue de la Cardonille,
RL   Montpellier Cedex 5 34396, France
XX
DR   MD5; eb9dfa791ad236cef71d4abcb720b79c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..487
FT                   /organism="Pan troglodytes"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9598"
FT   CDS_pept        <1..>487
FT                   /codon_start=2
FT                   /gene="PTR206"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:Q9N1M5"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9N1M5"
FT                   /protein_id="AAF40326.1"
FT                   /translation="VAICHPLHYSTIMALRLCASLVAAPWVIAILNPLLHTLMMAHLHF
FT                   CSDNVIHHFFCDINSLLPLSCSNTSLNQLSVLATVGLIFVVPSVCILVSYILIVSAVMK
FT                   VPSAQGKLKAFSICGSHLALVILFYGAITGVYMSPLSNHSTEKDSAASVIFMVVAPVL"
XX
SQ   Sequence 487 BP; 90 A; 138 C; 91 G; 168 T; 0 other;
     cgtggccatc tgtcaccctt tacattactc caccattatg gccctgcgcc tctgtgcctc        60
     tctggtagct gcaccttggg tcattgccat tttgaaccct ctcttgcaca ctcttatgat       120
     ggcccatctg cacttctgct ctgataatgt tatccaccat ttcttctgtg atatcaactc       180
     tctcctccct ctgtcctgtt ccaacaccag tcttaatcag ttgagtgttc tggctacggt       240
     ggggctgatc tttgtggtac cttcagtgtg tatcctggta tcctatatcc tcattgtttc       300
     tgctgtgatg aaagtccctt ctgcccaagg aaaactcaag gctttctcta tctgtggatc       360
     tcaccttgcc ttggtcattc ttttctatgg agcaatcaca ggggtctata tgagcccctt       420
     atccaatcac tctactgaaa aagactcagc cgcatcagtc atttttatgg ttgtagcacc       480
     tgtgttg                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page