(data stored in ACNUC3292 zone)

EMBL: AF181252

ID   AF181252; SV 1; linear; mRNA; STD; MUS; 3644 BP.
XX
AC   AF181252;
XX
DT   09-NOV-1999 (Rel. 61, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus testis TPR-containing protein involved in spermatogenesis TPIS
DE   (Tpis) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3644
RX   DOI; 10.1006/bbrc.1999.1477.
RX   PUBMED; 10527845.
RA   Takaishi M., Huh N.H.;
RT   "A tetratricopeptide repeat-containing protein gene, tpis, whose expression
RT   is induced with differentiation of spermatogenic cells";
RL   Biochem. Biophys. Res. Commun. 264(1):81-85(1999).
XX
RN   [2]
RP   1-3644
RA   Takaishi M., Huh N.;
RT   ;
RL   Submitted (27-AUG-1999) to the INSDC.
RL   Biochemistry, Toyama Med. and Pharmaceu. Univ., Sugitani 2630, Toyama
RL   9300194, Japan
XX
DR   MD5; f708f5f0765882f312de4b66edf25c66.
DR   Ensembl-Gn; ENSMUSG00000037617; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021792; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021753; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021731; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021759; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021534; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022198; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021050; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021503; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021627; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021605; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021696; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021629; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022221; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020794; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021106; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000047348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171205; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0040797; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0040760; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0040721; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0040759; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0040496; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0041227; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0040548; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0040414; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0040567; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0040529; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0040630; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0040514; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0041275; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0040140; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0039901; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3644
FT                   /organism="Mus musculus"
FT                   /chromosome="15"
FT                   /map="18.1 cM"
FT                   /strain="ICR"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        227..2932
FT                   /codon_start=1
FT                   /gene="Tpis"
FT                   /product="TPR-containing protein involved in
FT                   spermatogenesis TPIS"
FT                   /db_xref="GOA:Q80ZX8"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025986"
FT                   /db_xref="MGI:MGI:1349387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80ZX8"
FT                   /protein_id="AAF06160.1"
FT                   /translation="MTAKAKDCPSLWGFGTTKTFKIPIEHLDFKYIENCSDVKHLEKIL
FT                   YVLRSGEEGYYPELTEFCEKCLTNLAPKSRALRKDKPAETASSFSAEEWEKIDSDLKSW
FT                   VSEIKREENTRHFHDPENHPGVEDPLPPVRGSTCCPHSGKETYSKSKTAKKRIPRDYAE
FT                   WDKFDVEKECSKIDEDYKEKTVINNKAHLSKIETKIETAGLTEKEKSFLANREKGKGNE
FT                   AFYSGDYEEAVMYYTRSLSALPTAIAYNNRAQAEIKLQRWSSALEDCEKALELDPGNVK
FT                   ALLRRATTYKHQNKLQEAVDDLRKVLQVEPDNDLAKKTLSEVERDLKNSEPVSELQTKG
FT                   KRMVIEEVENSGDEGGKGSADERADGGSDEAAMGNIQKKLMVRRSEGGRRSRRGRTPGP
FT                   RAEQQGGLRETATASTGDSYYPEEPRAADNPSGLKRRGNELFRGGQFAEAAAQYSVAIA
FT                   QLEPTGSANADELSILYSNRAACYLKEGNCRDCIQDCNRALELHPFSVKPLLRRAMAYE
FT                   TLEQYRNAYVDYKTVLQIDCGIQLASDSANRIARILTELDGSKWRERLPPIPAVPTSEP
FT                   LRVWLPAAETPDQDPCPNNCMPSITDEKMFQALKEEGNQLVKDKNYKDAISKYNECLKI
FT                   NSKACAIYTNRALCYLKLGQFEEAKLDCDQALQIDGENVKASHRLALAQKGLENCRESG
FT                   VDPSQVLLSPDSSEAARHLDTKNDTAPPSKGRERRRIQVQEVDGSSDEEPERPAEASAT
FT                   SAPARDGVEDGGSAEPAEKLDVSKPTNAYEFGQVLSTISARKDEEACAHLLAITAPKDL
FT                   PLLLSNKLEGDTFLLLIQSLKSHLVAKDPSLVYEHLLYLSKAERFKTMLTLINKGQKEQ
FT                   MAQLFDGLSDTQSDGLTAEDVQALRRQYEL"
FT   polyA_site      3644
FT                   /gene="Tpis"
XX
SQ   Sequence 3644 BP; 1091 A; 824 C; 915 G; 814 T; 0 other;
     gagagaccca ggtgagcacc ctcggggcgt ggagaagcgg ccgcacacgc acactgtcga        60
     cgaacgtcct ttctagtctg ggaaggcgat tggaactttc caccgctgcg gttcacatgg       120
     gggtggagtt gccgcactgt ggtttcctgg ggacagccat ctgcttcagc cccaggaact       180
     acagcccaag ccggaggaac gactccctgc gccgaagctt gcagccatga ctgctaaggc       240
     taaggactgt ccatcattgt ggggctttgg aacaacaaaa acatttaaaa ttcccatcga       300
     acatttggat ttcaagtata ttgaaaactg ttcagatgtg aaacacctgg aaaaaattct       360
     ttatgtgctg aggtctggtg aagaaggcta ctatcctgaa ctcacggaat tttgcgagaa       420
     gtgcctcacc aacttggctc ctaaaagtcg agctctgagg aaggacaagc ctgcagagac       480
     agcatccagc ttttcagcgg aagagtggga aaaaatcgac agtgatctaa agagttgggt       540
     atcagaaatc aaaagagagg aaaatacacg tcacttccat gaccctgaaa accatcccgg       600
     agtggaagat cctctgcctc ctgtccgcgg ctccacctgc tgccctcaca gtggcaagga       660
     aacatattct aaaagtaaga cagctaagaa gaggattcca agggattatg cagaatggga       720
     taaatttgat gtggaaaaag aatgttcaaa gattgatgag gattacaaag aaaagactgt       780
     cataaacaac aaggctcatc tgtctaaaat tgagacaaaa atagaaacag caggtctgac       840
     tgagaaggaa aagagttttc ttgccaatcg tgaaaaggga aaagggaacg aggctttcta       900
     ctctggggac tatgaagagg ccgtgatgta ttacaccagg agcttatcag cccttcccac       960
     cgccattgcc tataacaatc gagctcaggc cgaaatcaag ttgcagagat ggagcagtgc      1020
     tcttgaagac tgtgagaagg ccttggagct agatcctgga aatgtaaaag ctctcctgag      1080
     acgagccact acatataaac atcaaaacaa gctccaggaa gctgtggacg acctgagaaa      1140
     ggtgctgcag gtggagccgg acaacgactt ggccaagaag accttatcag aggttgaaag      1200
     agatctgaag aattcagagc ctgtctctga gctccaaacc aaagggaaga ggatggttat      1260
     tgaagaagtt gaaaactcgg gagatgaagg tggaaaggga agtgcagatg agcgtgcaga      1320
     tggtggctcg gatgaggcgg ccatgggcaa cattcagaag aagctgatgg tccgccggag      1380
     cgagggtggc aggcggtcgc ggcggggccg gacaccgggg ccccgagctg agcagcaggg      1440
     aggcctgcga gagacagcga cggccagcac cggcgacagt tactacccgg aggagccgcg      1500
     agccgctgac aaccccagcg gcctcaagag acggggcaac gagctgttcc gcggcgggca      1560
     attcgcagag gcagccgcgc aatactcggt ggcgatagcg cagctggaac ccacaggaag      1620
     tgcaaatgcg gatgagctaa gcatcttgta ttcaaataga gcggcatgct acctcaaaga      1680
     aggaaactgc agggactgca tccaggattg taacagggct ctggaacttc atccgttctc      1740
     agtgaagcct cttctgcggc gagcaatggc ctatgagacc ttagagcaat acaggaacgc      1800
     atatgtggac tataaaacag tgctgcagat agattgtggg atccagctgg cgagcgacag      1860
     tgctaacaga atagcacgaa tcttaacaga gctagatgga tcaaaatggc gggagagact      1920
     gccacccatc ccagctgtac ccacatctga gccactgcga gtttggctcc ctgctgcaga      1980
     gaccccagac caagatccct gtcccaacaa ctgcatgccg agcatcacag atgaaaaaat      2040
     gtttcaagcc ctcaaggaag aaggaaatca acttgtaaag gacaaaaatt ataaagatgc      2100
     cattagtaaa tacaatgaat gcttaaagat taacagcaag gcatgtgcca tctatacaaa      2160
     cagggctctc tgttacctga agctgggcca gtttgaagag gcaaagctgg actgtgacca      2220
     ggcgcttcag atagacggcg agaatgtgaa agccagccac agactagcgc tcgcccagaa      2280
     aggactcgag aactgccggg aaagcggggt ggaccccagt caagtcctcc taagcccaga      2340
     ttccagtgaa gccgcccggc acctggacac taagaatgac acagcacctc ccagcaaagg      2400
     aagggagagg aggagaatcc aagtccaaga ggtggatggc agcagtgatg aggagcctga      2460
     gagacctgca gaggcctctg ctacctccgc acctgccaga gatggtgtgg aagatggagg      2520
     gtctgcagaa ccagcagaaa aactcgacgt ctccaagcct actaatgcct atgagtttgg      2580
     acaggtccta agcactatca gtgccaggaa agatgaagag gcctgtgcac atcttttagc      2640
     catcactgca cccaaagacc tgccactgtt gctaagtaac aaacttgagg gggacacgtt      2700
     cctcctcctc attcagtcac ttaaaagtca ccttgtggct aaagacccct ccctggtgta      2760
     tgagcatctc ctgtatctga gcaaagcaga gaggtttaag acgatgctga cactaattaa      2820
     caaaggccaa aaggagcaga tggcgcagct gtttgatggt ctgtcagaca cacagtccga      2880
     cggtttgacg gcagaggatg tacaggccct aagaaggcag tatgagcttt aacttggggt      2940
     tgctgagttc aagacagcaa acattgtgat gcagttgcat gggtaaagcc acacccagaa      3000
     ggatccctgt ttggacatca gatgttgtac ttatttttat atctagaaca tgtatattct      3060
     ataatctgat ttttatttat tgtaaatatt ctcttctgta ctagagccaa cacctttata      3120
     tttaataact atattcagaa cttggcaaat tatactctag cttataatac attttctttt      3180
     aatgacctac ccattaaaaa tttaaaatac attctttgtg gtggcagttc tttcaggttt      3240
     gacagcaatc agtgacttta gtcctttaaa agcaaatgtt agcagttgcg actccaccac      3300
     tttctgtccc actcaaatgc acaaaatcca ctttagagaa gtggcttact gtcacttgag      3360
     atgaaattca acacttaatg tctatgagat cattattagt ttattaattt agagccctaa      3420
     aggagatact ttttctaata tttagtgtga ctttgtcttc tacattgctt gtaagcaata      3480
     aaactgtatg aaacaaattc accctgcttt tgtatttgaa ttgtccccca ccccaacttt      3540
     ttgttttctg ctttatttct ttactctaac aagtggaaaa agaaactgga tactcctttt      3600
     tctgtgttaa aggtattttc tacacaataa acattaaagc cttt                       3644
//

If you have problems or comments...

PBIL Back to PBIL home page