(data stored in ACNUC3292 zone)

EMBL: AF181253

ID   AF181253; SV 1; linear; mRNA; STD; MUS; 2336 BP.
XX
AC   AF181253;
XX
DT   09-NOV-1999 (Rel. 61, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus skin TPR-containing protein involved in spermatogenesis TPIS
DE   (Tpis) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2336
RX   DOI; 10.1006/bbrc.1999.1477.
RX   PUBMED; 10527845.
RA   Takaishi M., Huh N.H.;
RT   "A tetratricopeptide repeat-containing protein gene, tpis, whose expression
RT   is induced with differentiation of spermatogenic cells";
RL   Biochem. Biophys. Res. Commun. 264(1):81-85(1999).
XX
RN   [2]
RP   1-2336
RA   Takaishi M., Huh N.;
RT   ;
RL   Submitted (27-AUG-1999) to the INSDC.
RL   Biochemistry, Toyama Med. and Pharmaceu. Univ., Sugitani 2630, Toyama
RL   9300194, Japan
XX
DR   MD5; 9bbfd790c8062c4825ee60b669fcadc0.
DR   Ensembl-Gn; ENSMUSG00000037617; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021792; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021753; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021731; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021759; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021534; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022198; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021050; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021503; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021627; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021605; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021696; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021629; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022221; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020794; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021106; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000047348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171205; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0040797; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0040760; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0040721; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0040759; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0040496; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0041227; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0040548; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0040414; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0040567; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0040529; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0040630; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0040514; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0041275; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0040140; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0039901; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2336
FT                   /organism="Mus musculus"
FT                   /chromosome="15"
FT                   /map="18.1 cM"
FT                   /strain="ICR"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /tissue_type="skin"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        35..1624
FT                   /codon_start=1
FT                   /gene="Tpis"
FT                   /product="TPR-containing protein involved in
FT                   spermatogenesis TPIS"
FT                   /db_xref="GOA:Q80ZX8"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025986"
FT                   /db_xref="MGI:MGI:1349387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80ZX8"
FT                   /protein_id="AAF06161.1"
FT                   /translation="MGNIQKKLMVRRSEGGRRSRRGRTPGPRAEQQGGLRETATASTGD
FT                   SYYPEEPRAADNPSGLKRRGNELFRGGQFAEAAAQYSVAIAQLEPTGSANADELSILYS
FT                   NRAACYLKEGNCRDCIQDCNRALELHPFSVKPLLRRAMAYETLEQYRNAYVDYKTVLQI
FT                   DCGIQLASDSANRIARILTELDGSKWRERLPPIPAVPTSEPLRVWLPAAETPDQDPCPN
FT                   NCMPSITDEKMFQALKEEGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKL
FT                   GQFEEAKLDCDQALQIDGENVKASHRLALAQKGLENCRESGVDPSQVLLSPDSSEAARH
FT                   LDTKNDTAPPSKGRERRRIQVQEVDGSSDEEPERPAEASATSAPARDGVEDGGSAEPAE
FT                   KLDVSKPTNAYEFGQVLSTISARKDEEACAHLLAITAPKDLPLLLSNKLEGDTFLLLIQ
FT                   SLKSHLVAKDPSLVYEHLLYLSKAERFKTMLTLINKGQKEQMAQLFDGLSDTQSDGLTA
FT                   EDVQALRRQYEL"
XX
SQ   Sequence 2336 BP; 676 A; 554 C; 559 G; 547 T; 0 other;
     ctcacctccc ggtgcgccct tctctacagc ggccatgggc aacattcaga agaagctgat        60
     ggtccgccgg agcgagggtg gcaggcggtc gcggcggggc cggacaccgg ggccccgagc       120
     tgagcagcag ggaggcctgc gagagacagc gacggccagc accggcgaca gttactaccc       180
     ggaggagccg cgagccgctg acaaccccag cggcctcaag agacggggca acgagctgtt       240
     ccgcggcggg caattcgcag aggcagccgc gcaatactcg gtggcgatag cgcagctgga       300
     acccacagga agtgcaaatg cggatgagct aagcatcttg tattcaaata gagcggcatg       360
     ctacctcaaa gaaggaaact gcagggactg catccaggat tgtaacaggg ctctggaact       420
     tcatccgttc tcagtgaagc ctcttctgcg gcgagcaatg gcctatgaga ccttagagca       480
     atacaggaac gcatatgtgg actataaaac agtgctgcag atagattgtg ggatccagct       540
     ggcgagcgac agtgctaaca gaatagcacg aatcttaaca gagctagatg gatcaaaatg       600
     gcgggagaga ctgccaccca tcccagctgt acccacatct gagccactgc gagtttggct       660
     ccctgctgca gagaccccag accaagatcc ctgtcccaac aactgcatgc cgagcatcac       720
     agatgaaaaa atgtttcaag ccctcaagga agaaggaaat caacttgtaa aggacaaaaa       780
     ttataaagat gccattagta aatacaatga atgcttaaag attaacagca aggcatgtgc       840
     catctataca aacagggctc tctgttacct gaagctgggc cagtttgaag aggcaaagct       900
     ggactgtgac caggcgcttc agatagacgg cgagaatgtg aaagccagcc acagactagc       960
     gctcgcccag aaaggactcg agaactgccg ggaaagcggg gtggacccca gtcaagtcct      1020
     cctaagccca gattccagtg aagccgcccg gcacctggac actaagaatg acacagcacc      1080
     tcccagcaaa ggaagggaga ggaggagaat ccaagtccaa gaggtggatg gcagcagtga      1140
     tgaggagcct gagagacctg cagaggcctc tgctacctcc gcacctgcca gagatggtgt      1200
     ggaagatgga gggtctgcag aaccagcaga aaaactcgac gtctccaagc ctactaatgc      1260
     ctatgagttt ggacaggtcc taagcactat cagtgccagg aaagatgaag aggcctgtgc      1320
     acatctttta gccatcactg cacccaaaga cctgccactg ttgctaagta acaaacttga      1380
     gggggacacg ttcctcctcc tcattcagtc acttaaaagt caccttgtgg ctaaagaccc      1440
     ctccctggtg tatgagcatc tcctgtatct gagcaaagca gagaggttta agacgatgct      1500
     gacactaatt aacaaaggcc aaaaggagca gatggcgcag ctgtttgatg gtctgtcaga      1560
     cacacagtcc gacggtttga cggcagagga tgtacaggcc ctaagaaggc agtatgagct      1620
     ttaacttggg gttgctgagt tcaagacagc aaacattgtg atgcagttgc atgggtaaag      1680
     ccacacccag aaggatccct gtttggacat cagatgttgt acttattttt atatctagaa      1740
     catgtatatt ctataatctg atttttattt attgtaaata ttctcttctg tactagagcc      1800
     aacaccttta tatttaataa ctatattcag aacttggcaa attatactct agcttataat      1860
     acattttctt ttaatgacct acccattaaa aatttaaaat acattctttg tggtggcagt      1920
     tctttcaggt ttgacagcaa tcagtgactt tagtccttta aaagcaaatg ttagcagttg      1980
     cgactccacc actttctgtc ccactcaaat gcacaaaatc cactttagag aagtggctta      2040
     ctgtcacttg agatgaaatt caacacttaa tgtctatgag atcattatta gtttattaat      2100
     ttagagccct aaaggagata ctttttctaa tatttagtgt gactttgtct tctacattgc      2160
     ttgtaagcaa taaaactgta tgaaacaaat tcaccctgct tttgtatttg aattgtcccc      2220
     caccccaact ttttgttttc tgctttattt ctttactcta acaagtggaa aaagaaactg      2280
     gatactcctt tttctgtgtt aaaggtattt tctacacaat aaacattaaa gccttt          2336
//

If you have problems or comments...

PBIL Back to PBIL home page