(data stored in SCRATCH3701 zone)

EMBL: AF188482

ID   AF188482; SV 1; linear; genomic DNA; STD; PRO; 2978 BP.
XX
AC   AF188482;
XX
DT   11-APR-2001 (Rel. 67, Created)
DT   21-MAR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Rickettsia typhi PS 120 kDa (D) gene, partial cds.
XX
KW   .
XX
OS   Rickettsia typhi
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;
OC   Rickettsiaceae; Rickettsieae; Rickettsia; typhus group.
XX
RN   [1]
RP   1-2978
RX   PUBMED; 11491333.
RA   Sekeyova Z., Roux V., Raoult D.;
RT   "Phylogeny of Rickettsia spp. inferred by comparing sequences of 'gene D',
RT   which encodes an intracytoplasmic protein";
RL   Int. J. Syst. Evol. Microbiol. 51(Pt 4):1353-1360(2001).
XX
RN   [2]
RP   1-2978
RA   Sekeyova Z., Roux V., Raoult D.;
RT   ;
RL   Submitted (21-SEP-1999) to the INSDC.
RL   Unite des Rickettsies, Faculte de Medecine, Universite de la Mediterranee,
RL   27 bd. J. Moulin, Marseille 13385, France
XX
DR   MD5; cd101467b280f898c0ea7e47bcdf71e5.
DR   EuropePMC; PMC308961; 14662925.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2978
FT                   /organism="Rickettsia typhi"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:785"
FT   gene            <1..>2978
FT                   /gene="D"
FT   CDS_pept        <1..>2978
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /gene="D"
FT                   /product="PS 120 kDa"
FT                   /note="non rOmpB 120 kD protein"
FT                   /db_xref="GOA:Q9AJ63"
FT                   /db_xref="InterPro:IPR020954"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AJ63"
FT                   /protein_id="AAK31303.1"
FT                   /translation="VNREFTEAEKQQQMQQEQEFFSQSILDIVDDGFIVASSSQSTPSI
FT                   SVLSNSLPHGDQKSDPITEAIRKEILEKQRDILREYLANTNPELAAQIAKEEDDKKFRA
FT                   FLSNQDNYALINKAFEDPETKKNLEEVEIVGYRNILSTYSAASGYPGGFKPVQWENHVS
FT                   ANDLRATVVKNDAGDELCTLNETTVKTKPFTLAKQDGTQVQISSYREIDFPIKLDKADG
FT                   SMHLSMVALKADGTKPAKDKAVYFTAHYEEGPNGKPQLKEISSPQPLKFVGTGDDAVAY
FT                   IEHGGEIYTLAVTRGKYKAMMKEVALNNGQSVDLSQTIAEDLTKVQGPSHVRHTPIITP
FT                   NQELELSIETHSNQQVPPITTFNKPLQPEISQTHQLQPQQAQSSGIPNLVLNAAHALSI
FT                   SMQDLLHNINASLTQKQDINKQSDLIKEAANTILNNKKSDFAEKQYNIIALTENTLSNK
FT                   DIIADAKVNVVSALLETIQNDQNTLDIQKSKILEATVAITLNSENIELKQKQQILEKVV
FT                   DVSLSIKDDISRAVAIDSITDAVIKSNIANKDKEQIFMTIFDQVNSYEFSNITKQKLLG
FT                   SMLKKAVETKVISPGQQQLIHQNLHKITTEHTKRDTIEKVNNILLDPFSNTVLKTTNIQ
FT                   VITANVLDSPVPVEIKSELIQVVTQKVAESALEPKDKTEIVKGIGKIIATHSDTSLPLY
FT                   DKGVIMESVAKGIVESKTDLRERELITEGLVNGIYEVKGDKAVVHAISSVIANSNINQS
FT                   EKEVLKKSQDIVSERVLDKEIQNLDGELKEKNIEESKLRDDIYNKTQDVANELNIKTFL
FT                   DDNHGKREVSEEVPKNTSSLLNDISQRTIEKVNNLRAMLSQDANLKTFEEKKDESTKKV
FT                   DELVKAFDNKSSTEEQQNFIKSHLIDNKTLSREVRLQIIDNLLKAQAQKRAETIENLSA
FT                   KTEDVRVVSGKSELEPISKDEPYIQKAKMVVVERDRVGIKDNIKIMGALINARDSIQSE
FT                   NLP"
XX
SQ   Sequence 2978 BP; 1247 A; 422 C; 512 G; 797 T; 0 other;
     tggtaaatag agaatttacg gaagcagaaa aacaacaaca aatgcaacaa gaacaagaat        60
     ttttttctca atctatacta gatatagttg atgatggttt tatagttgca tcttcttctc       120
     aatctacacc ttcaattagt gttttatcaa acagtctccc acatggtgat cagaaatcag       180
     atccaataac tgaagctata agaaaagaaa tccttgaaaa acaaagagat atattaaggg       240
     aatatttggc taatacaaat ccagaactcg ctgcacaaat agcaaaagaa gaagacgata       300
     aaaaattccg tgcttttttg agtaatcaag ataattatgc tttaattaat aaagcttttg       360
     aagatccgga gacgaaaaag aacctagaag aagttgaaat agtcggttat agaaatattc       420
     tctctacata tagtgctgcg agtggatatc caggtggatt taaaccggta cagtgggaaa       480
     atcacgtaag tgcaaacgat cttagagcaa cagtagttaa aaatgatgca ggtgatgaac       540
     tctgtacctt aaatgaaaca actgttaaaa ctaagccttt tactttagct aaacaagacg       600
     gtactcaggt tcagatcagc tcatataggg aaatagattt tcctataaaa cttgataaag       660
     ccgatgggtc tatgcattta tctatggtag cattaaaagc tgatggtaca aaaccagcta       720
     aagataaagc agtatatttt actgcacact atgaagaagg gccaaatggt aaaccacaac       780
     ttaaagaaat cagttcacca caacctttaa aatttgtagg cactggtgat gatgcagtag       840
     cttatattga gcatggtgga gaaatttata cgcttgcagt tacacgtggt aagtataaag       900
     caatgatgaa agaggtagca ctaaacaatg ggcagagcgt tgacttatca caaactatag       960
     ctgaagattt aacaaaggta caaggtccat ctcatgtgag acatacacca ataataactc      1020
     caaatcaaga attagaatta tctattgaaa cacattctaa tcaacaagtg ccaccaatca      1080
     ctacgttcaa taaaccacta caacctgaaa tttcacaaac acatcaattg caaccacaac      1140
     aagctcaatc ttcaggaatt ccaaatctag tactgaatgc agctcatgct ttatcaataa      1200
     gtatgcaaga tttgttacat aatataaatg catctttaac acaaaaacaa gacatcaata      1260
     agcaaagcga tttaattaag gaagcagcta acacaattct taataataag aaaagtgatt      1320
     ttgctgaaaa gcagtataat ataattgctt taactgaaaa tacactctct aataaagaca      1380
     ttatagcaga cgctaaagta aatgtagtca gtgcattatt agaaactata caaaatgatc      1440
     agaatacact agacatacaa aaatcaaaaa tacttgaagc tacagtagct attacattaa      1500
     actcagagaa tatagaacta aaacaaaaac agcaaatatt agagaaggta gtagatgtca      1560
     gtttaagtat taaagatgat ataagtagag ctgtagcaat tgatagtatt acggatgctg      1620
     taataaaaag taatattgct aataaagata aagagcaaat atttatgaca atatttgatc      1680
     aagttaatag ctatgaattc agcaatataa caaaacaaaa attgttaggt tctatgttaa      1740
     agaaagctgt agaaacaaaa gttattagtc cgggacaaca gcaattgatc catcagaatt      1800
     tacataagat tacgacagaa cacactaaaa gagatacaat agaaaaagta aataatattt      1860
     tactggatcc tttcagtaat actgtattaa aaacaacaaa tatacaagtt attacagcta      1920
     atgttctaga tagtccagtt ccagtagaga taaaaagtga attaattcaa gtagttactc      1980
     aaaaagtggc agaaagtgca cttgaaccta aagacaaaac agagattgtt aaaggtatag      2040
     gcaagattat agcgactcat agtgatactt ctttaccttt atatgataaa ggagtgatta      2100
     tggagtcagt ggcaaaaggt attgtcgaaa gtaagactga tttacgtgag agagagctaa      2160
     tcactgaagg gttagtaaat ggaatttatg aagtaaaagg agacaaggca gttgttcatg      2220
     caatttctag tgtgatagct aatagtaata ttaatcaatc tgagaaagaa gtacttaaaa      2280
     aatctcaaga tatagtaagt gagagagttt tagataaaga aatacaaaat ttagatggag      2340
     agttaaaaga gaaaaatata gaagaatcta aacttcgtga tgatatatat aacaaaacgc      2400
     aagatgttgc taatgaatta aatattaaaa cttttttaga tgataaccac ggaaaacgtg      2460
     aagtctcaga agaagtacca aaaaacactt ctagcctatt aaatgatatc tctcagcgta      2520
     caattgagaa agtcaataat ttgcgagcta tgctctctca agatgctaat cttaaaactt      2580
     ttgaagaaaa aaaagatgaa tcaacaaaaa aagtagatga gctagtaaag gcatttgata      2640
     ataaatcttc tactgaagaa cagcaaaatt tcattaaatc tcatttaatt gataataaaa      2700
     ctttatctag agaagtacgt ttacaaatta tagataattt attaaaagca caggcacaaa      2760
     aacgagcaga aacaattgaa aaccttagtg ctaaaacgga agatgtaaga gtagtatcag      2820
     gaaagtctga attagaacct ataagtaaag acgaaccata tattcaaaaa gctaaaatgg      2880
     tagtagtaga aagagatagg gttggtatta aagacaatat aaaaattatg ggtgcattaa      2940
     taaatgcaag agatagtatt cagtctgaaa atttacca                              2978
//

If you have problems or comments...

PBIL Back to PBIL home page