(data stored in ACNUC21429 zone)

EMBL: AF189009

ID   AF189009; SV 1; linear; mRNA; STD; HUM; 3334 BP.
XX
AC   AF189009;
XX
DT   15-DEC-1999 (Rel. 62, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens ubiquitin-like product Chap1/Dsk2 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3334
RX   DOI; 10.1016/S0014-5793(00)01135-2.
RX   PUBMED; 10675567.
RA   Kaye F.J., Modi S., Ivanovska I., Koonin E.V., Thress K., Kubo A.,
RA   Kornbluth S., Rose M.D.;
RT   "A family of ubiquitin-like proteins binds the ATPase domain of Hsp70-like
RT   Stch";
RL   FEBS Lett. 467(2-3):348-355(2000).
XX
RN   [2]
RP   1-3334
RA   Kaye F.J.;
RT   ;
RL   Submitted (22-SEP-1999) to the INSDC.
RL   Medicine Branch, NCI, Naval Hospital, Bldg 8/Rm 5101/Naval Hospital,
RL   Bethesda, MD 20889, USA
XX
DR   MD5; 2ac38ab68c60e0bfa9cbd1485d22d38d.
DR   Ensembl-Gn; ENSG00000188021; homo_sapiens.
DR   Ensembl-Tr; ENST00000338222; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3334
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        236..2110
FT                   /codon_start=1
FT                   /product="ubiquitin-like product Chap1/Dsk2"
FT                   /note="similar to Saccharomyces cerevisiae Dsk2"
FT                   /db_xref="GOA:Q9UHD9"
FT                   /db_xref="H-InvDB:HIT000072992.12"
FT                   /db_xref="HGNC:HGNC:12509"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR028430"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="PDB:1J8C"
FT                   /db_xref="PDB:2NBV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UHD9"
FT                   /protein_id="AAF17237.1"
FT                   /translation="MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEE
FT                   FAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKS
FT                   QNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTN
FT                   FSELQSQMQQQLMASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEIS
FT                   HLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLN
FT                   AAQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGS
FT                   GSGNSSSNATGNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSL
FT                   SQNPDLAAQMMLNSPLFTANPQLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQI
FT                   QQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIG
FT                   PTGPAAPPGSTGSGGPTGPTVSSAAPRETTSPTSESGPNQQFIQQMVQALAGANAPQLP
FT                   NPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS"
XX
SQ   Sequence 3334 BP; 896 A; 889 C; 712 G; 836 T; 1 other;
     cggaggaggc ccagagaccg gagcgcggag acctcagcca gcggcctacg cccaggcctt        60
     tctccaccgg aggaccaggg aaccgcagtc ttcatcacag aggtaccgtg ctccgcgctc       120
     cccgcctgac ccggcccagc ccgctgcggc ggtgcctcct tccttcctcc ttccctcgcg       180
     ctctctcttt cgcccgcccg cgccttccct gcccgcctgc gtcaccgcgg ccgccatggc       240
     tgagaatggc gagagcagcg gccccccgcg cccctcccgc ggccctgctg cggcccaagg       300
     ctcggctgct gccccggctg agcctaaaat catcaaagtc acggtgaaga ctcccaaaga       360
     gaaagaggag ttcgcggtgc ccgagaacag ctcggttcag cagtttaagg aagcgatttc       420
     gaaacgcttc aaatcccaaa ccgatcagct agtgctgatt tttgccggaa aaatcttaaa       480
     agatcaagat accttgatcc agcatggcat ccatgatggg ctgactgttc accttgtcat       540
     caaaagccag aaccgacctc agggccagtc cacgcagcct agcaatgccg cgggaactaa       600
     cactacctcg gcgtcgactc ccaggagtaa ctccacacct atttccacaa atagcaaccc       660
     gtttgggttg gggagcctgg gaggacttgc aggccttagc agcctgggct tgagctcgac       720
     caacttctct gagctccaga gccagatgca gcagcagctt atggccagcc ctgagatgat       780
     gatccaaata atggaaaatc cctttgttca gagcatgctt tcgaatcccg atctgatgag       840
     gcagctgatt atggctaatc cacagatgca gcaattgatt cagagaaacc cagaaatcag       900
     tcacctgctc aacaacccag acataatgag gcagacactc gaaattgcca ggaatccagc       960
     catgatgcaa gagatgatga gaaatcaaga cctggctctt agcaatctag aaagcatccc      1020
     aggtggctat aatgctttac ggcgcatgta cactgacatt caagagccga tgctgaatgc      1080
     cgcacaagag cagtttgggg gtaatccatt tgcctccgtg gggagtagtt cctcctctgg      1140
     ggaaggtacg cagccttccc gcacagaaaa tcgcgatcca ctacccaatc catgggcacc      1200
     accgccagct acccagagtt ctgcaactac cagcacgacc acaagcactg gtagtgggtc      1260
     tggcaatagt tccagcaatg ctactgggaa caccgttgct gccgctaatt atgtcgccag      1320
     catctttagt accccaggca tgcagagcct gctgcaacag ataactgaaa acccccagct      1380
     gattcagaat atgctgtcgg cgccctacat gagaagcatg atgcagtcgc tgagccagaa      1440
     tccagatttg gctgcacaga tgatgctgaa tagcccgctg tttactgcaa atcctcagct      1500
     gcaggagcag atgcggccac agctcccagc cttcctgcag cagatgcaga atccagacac      1560
     actatcagcc atgtcaaacc caagagcaat gcaggcttta atgcagatcc agcaggggct      1620
     acagacatta gccactgaag cacctggcct gattccgagc ttcactccag gtgtgggggt      1680
     gggggtgctg ggaaccgcta taggccctgt aggcccagtc acccccatag gccccatagg      1740
     ccctatagtc ccttttaccc ccataggccc cattgggccc ataggaccca ctggccctgc      1800
     agccccccct ggctccaccg gctctggtgg ccccacgggg cctactgtgt ccagcgctgc      1860
     acctagagaa accacgagtc ctacatcaga atctggaccc aaccagcagt tcattcagca      1920
     aatggtgcag gccctggctg gagcaaatgc tccacagctg ccgaatccag aagtcagatt      1980
     tcagcaacaa ctggaacagc tcaacgcaat ggggttctta aaccgtgaag caaacttgca      2040
     ggccctaata gcaacaggag gcgacatcaa tgcagccatt gaaaggctgc tgggctccca      2100
     gccatcgtaa tcacatttct gtacctggaa aaaaaatgta tcttattttt gataatggct      2160
     cttaaatctt taaacacaca cacaaaatcg ttctttactt tcattttgat tcttttaaat      2220
     ctgtctagtt gtaagtctaa tatgatgcat tttaagatgg agtccctccc tcctacttcc      2280
     ctcactccct ttctcctttg cttatttttc ctaccttccc ttcctcttgt ctccccactc      2340
     cctccctctt tgtttccttc cttccttatt tcctttagtt tccttcctta gccgttttta      2400
     gtggtgggaa tcaaatgctg tttcactcaa aagtgttgca tgcaaacact tctctttatt      2460
     ctgcatttat tgtgattttt ggaaacaggt atcaaccttc acaggttggg tgcaacaagt      2520
     gttgtcctac agatgtccaa tttatttgca tttttaaaca ttagcctatg atagtaattt      2580
     aatgtagaat gaagatatta aaaccagaag caaattattt gaagccctct aatttgtggt      2640
     acgatattgc cttattgtga ctttggcakg tatttttgct agcaaaatgc tgtaagattt      2700
     ataccattga tcttttttgc tatatttgta tacagtacag taagcacaat tggccctgta      2760
     catctaaaaa tattacagta gaatctgagt gtaatatgtg taaccaaaat gagaaagaat      2820
     acaagaaatg tttctggagc tagttatgtc tcacaatttt gtagaatctt acagcatctt      2880
     tgataaactt ctcagtgaaa atgttggcta ggcaagttca gttaaaacat agtacaaatg      2940
     tttatcctgg catctctaag tacacattta attgcacaga aaatttacag tgtaacattg      3000
     cgtcaacatt tgcagattga ctgcatatga ccttaatctt tgtgcagcct gaaggatcag      3060
     tgtagtaatg ccaggaaagt gctttttacc taagacttcc ttctcagctt ctcccataaa      3120
     cagaccctaa tatgcatttt gatttgtaat tggaaatgta actttccctg aaagtgtcat      3180
     gtgatgtttg cattactttt aactgctatg tataaaggaa agtgtgtctt ttgacttcat      3240
     cagttatttc tcttgcgccc acagaaaaat gcattaaaaa tgactaaaaa aaataaaaaa      3300
     ttaaaaaatg gaaaaaaaaa aaaaaaaaaa aaaa                                  3334
//

If you have problems or comments...

PBIL Back to PBIL home page