(data stored in SCRATCH zone)

EMBL: AF195894

ID   AF195894; SV 1; linear; mRNA; STD; PLN; 369 BP.
XX
AC   AF195894;
XX
DT   20-OCT-2000 (Rel. 65, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Arabidopsis thaliana arabinogalactan protein (AGP13) mRNA, complete cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-369
RX   DOI; 10.1105/tpc.12.9.1751.
RX   PUBMED; 11006345.
RA   Schultz C.J., Johnson K.L., Currie G., Bacic A.;
RT   "The classical arabinogalactan protein gene family of arabidopsis";
RL   Plant Cell 12(9):1751-1768(2000).
XX
RN   [2]
RP   1-369
RA   Schultz C.J., Johnson K.L., Bacic A.;
RT   ;
RL   Submitted (18-OCT-1999) to the INSDC.
RL   School of Botany, University of Melbourne, Vic 3010, Australia
XX
DR   MD5; c3b03848b83632b3ec4a984dd956a4b0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..369
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /note="ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        57..236
FT                   /codon_start=1
FT                   /gene="AGP13"
FT                   /product="arabinogalactan protein"
FT                   /db_xref="GOA:Q9STQ3"
FT                   /db_xref="InterPro:IPR039281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ3"
FT                   /protein_id="AAG24281.1"
FT                   /translation="MEAMKMRLFVAVLVAAMAFSAVQQAAAVEAPAPSPTSDASLAIPA
FT                   FFASVATLAFGFLF"
XX
SQ   Sequence 369 BP; 76 A; 84 C; 71 G; 138 T; 0 other;
     aacactaaac atatagtctc ttcgtgcttt ctcaagaacc acctagagat aacccaatgg        60
     aggcaatgaa gatgagactc tttgtggcgg ttttggtggc agcgatggct ttctctgcgg       120
     tgcaacaggc tgccgcggtg gaggctccag ctccgagtcc tacctccgat gcttccttgg       180
     ccatccccgc tttcttcgcc tcggtagcca ctttggcctt tgggtttctc ttctagacaa       240
     atttgttttt gtctttttaa tgttataaaa atcatattct tgttttttta tttcggtttt       300
     cattcttatg tactgttcta agattttcca catttgaatc aataaaatta tctcggtcac       360
     ttttttttt                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page