(data stored in ACNUC32233 zone)

EMBL: AF203696

ID   AF203696; SV 1; linear; mRNA; STD; MUS; 396 BP.
XX
AC   AF203696;
XX
DT   03-DEC-2000 (Rel. 66, Created)
DT   10-DEC-2000 (Rel. 66, Last updated, Version 2)
XX
DE   Mus musculus BIV spectrin mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-396
RX   DOI; 10.1083/jcb.151.5.985.
RX   PUBMED; 11086001.
RA   Berghs S., Aggujaro D., Dirkx R.Jr., Maksimova E., Stabach P.,
RA   Hermel J.-M., Zhang J.-P., Philbrick W., Slepnev V., Ort T., Solimena M.;
RT   "betaIV spectrin, a new spectrin localized at axon initial segments and
RT   nodes of ranvier in the central and peripheral nervous system";
RL   J. Cell Biol. 151(5):985-1002(2000).
XX
RN   [2]
RP   1-396
RA   Berghs S., Aggujaro D., Dirkx R.Jr., Stabach P., Hermel J.-M.,
RA   Maksimova E., Zhang J.-P., Slepnev V., Ort T., Philbrick W., Solimena M.;
RT   ;
RL   Submitted (10-NOV-1999) to the INSDC.
RL   Internal Medicine/Endocrinology, Yale University School of Medicine, 333
RL   Cedar Street, New Haven, CT 06520, USA
XX
DR   MD5; ad0940cdf66eadf0b6237cee0b71a40d.
DR   EuropePMC; PMC2174349; 11086001.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..396
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="B2"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..>396
FT                   /codon_start=3
FT                   /product="BIV spectrin"
FT                   /note="cytoskeletal protein"
FT                   /db_xref="GOA:Q9EQM0"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="MGI:MGI:1890574"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EQM0"
FT                   /protein_id="AAG35643.1"
FT                   /translation="KPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQS
FT                   FAELDKRLLHMESQLQDVDPGGDLATVNSQLKKLQSMESQVEEWCREVGELQAQTAALP
FT                   LEQASKELVGERQSAVGERLVRLLEPL"
XX
SQ   Sequence 396 BP; 85 A; 103 C; 152 G; 56 T; 0 other;
     agaaaccgga gctggcagcc tctgtgcgca agaaattagg tgagatccgg cagtgctggg        60
     cggagctgga gagcaccaca caggccaagg cgcgccagct cttcgaggcc agcaaggcgg       120
     accagctagt gcagagcttc gcggagctgg acaagcggct gcttcacatg gaaagccagc       180
     tgcaagacgt agaccccggt ggggacctgg ccactgtcaa cagccagctc aagaagttac       240
     agtccatgga gtctcaggtg gaggagtggt gccgagaggt gggcgagctt caggcgcaga       300
     cggcggcgct tccgctggag caggcgagca aggagttggt gggggagcgg cagagtgcgg       360
     tgggcgagcg cctggtgcgc ctgctcgagc cgttaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page