(data stored in ACNUC13479 zone)

EMBL: AF206715

ID   AF206715; SV 1; linear; genomic DNA; STD; PLN; 4519 BP.
XX
AC   AF206715;
XX
DT   15-DEC-1999 (Rel. 62, Created)
DT   07-APR-2004 (Rel. 79, Last updated, Version 3)
XX
DE   Arabidopsis thaliana transcription factor GT-3a (GT-3a) gene, complete cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-4519
RX   DOI; 10.1016/S0014-5793(04)00222-4.
RX   PUBMED; 15044016.
RA   Ayadi M., Delaporte V., Li Y.F., Zhou D.X.;
RT   "Analysis of GT-3a identifies a distinct subgroup of trihelix DNA-binding
RT   transcription factors in Arabidopsis";
RL   FEBS Lett. 562(1-3):147-154(2004).
XX
RN   [2]
RP   1-4519
RA   Ayadi M., Zhou D.X.;
RT   ;
RL   Submitted (19-NOV-1999) to the INSDC.
RL   Plant Molecular Genetics, Universite de Picardie, 33, rue Saint Leu, Amiens
RL   80039, France
XX
DR   MD5; a283892eb3159873b86b8ded4891f6f9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4519
FT                   /organism="Arabidopsis thaliana"
FT                   /ecotype="C24"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:3702"
FT   gene            1585..>3415
FT                   /gene="GT-3a"
FT   regulatory      1585..1590
FT                   /gene="GT-3a"
FT                   /regulatory_class="TATA_box"
FT   mRNA            join(1654..2082,2780..>3415)
FT                   /gene="GT-3a"
FT                   /product="transcription factor GT-3a"
FT   regulatory      1665..1669
FT                   /gene="GT-3a"
FT                   /regulatory_class="TATA_box"
FT   mRNA            join(1728..2082,2780..>3415)
FT                   /gene="GT-3a"
FT                   /product="transcription factor GT-3a"
FT   CDS_pept        join(1747..2082,2780..3415)
FT                   /codon_start=1
FT                   /gene="GT-3a"
FT                   /product="transcription factor GT-3a"
FT                   /note="DNA-binding protein"
FT                   /db_xref="GOA:Q9SDW0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR027759"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SDW0"
FT                   /protein_id="AAF17610.1"
FT                   /translation="MDRRNPFQHHHHHHQLHHHLIQQQQLPPPPLSTTATMDPGGGGGG
FT                   GERIPQWSIEETKELLAIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSAEQCKSKW
FT                   KNLVTRYKACETTEPDAIRQQFPFYNEIQSIFEARMQRMLWSEATEPSTSSKRKHHQFS
FT                   SDDEEEEVDEPNQDINEELLSLVETQKRETEVITTSTSTNPRKRAKKGKGVASGTKAET
FT                   AGNTLKDILEEFMRQTVKMEKEWRDAWEMKEIEREKREKEWRRRMAELEEERAATERRW
FT                   MEREEERRLREEARAQKRDSLIDALLNRLNRDHNDDHHNQGF"
XX
SQ   Sequence 4519 BP; 1584 A; 714 C; 788 G; 1433 T; 0 other;
     gatcattcac tagagtagtc gacattatta ttaatagtat aaataaataa ggtgaatcca        60
     cgtgggatga caggtggagc gaagtctagt gcatgtcatg taagattttg atttactttc       120
     aacacgcttc atcgctattt ggaccacttc gctgactttt tttttttttt tttttttctt       180
     actactgagt agtactagta tttcttacac atatcagagc caaaaataca accccgacga       240
     atctttcttt agatacaaat aaaaaatatt tactcctaca agtttcattc accgtacgtt       300
     ttacttgtta tatcattgca catgacgcgg cttctaaata tgtactacca tatgtgtgtt       360
     tgggaatctg acagttgata ttgcactgga cccaaaccat ttacagaaca agagtacttt       420
     tctctgttcg tacgcattat ttgttttgtg ccgactgcga atataacgat ttccatttat       480
     tcatatacta aatatcatac aatccataaa tgaatagttc tttctttttt ttcttggggg       540
     aatttacaat tccaatcaaa ttaatttctt agctaatcat aacggtagtc ttgttttctg       600
     taacttaatt cttcttcttt tttattttga taggaacgtt aggtatctat tatgtaaaac       660
     ttgctaacaa caattctcta attctttgtt tatatctgat ctcttcctcc atgacacggg       720
     gctaatcaaa cttctaaaag catattgatc caatagctta tttaatatat tttgtctgtc       780
     aaccattagg ttacttttgt tacgatgaat ttttcaaaag aaaaatacaa gaattatggg       840
     atgaggaaaa tctagtgggt caattgacca taaaggctag aaatgattat ttaattttga       900
     ggcttgagaa agaaaaaaaa atgaagaata aaaatcggat tgtgactcgt aactcgtaag       960
     cgtgacgaaa tattaacgca acatttatat gtattgggac aaattattaa cgaataacta      1020
     ccaaatgcaa aaaatacgag acagttgagt acttgagctt ggtcacaaaa tcatcatcaa      1080
     ggaaaaacaa taaccataca gtaaaaatat agttctacaa ctttacaaat ttgaaagcgt      1140
     gtttagaatg atgcacacaa ataatcaatc tgtcaaaaaa aacatattgt ttgattttac      1200
     tctaagatta aggcgattgt ttttacttaa gatattctta actgatgcaa gttaccccag      1260
     taattgtttg agattgctat ttttaaactc tagaatacga agaaaaaaaa agtatgaatt      1320
     atttagttag ctgctttaaa tctagagttt atccgaaaaa gggatatcta agctttatta      1380
     tttttaatgt aatcacgaat tgtgtccttt tcaccaaaag agtcattcgt gttcgtattt      1440
     tattcaacta aataattcta taagttctag tatattcaat aattattaaa aaatctcatc      1500
     ttaataattt taattagaga aaagaacaaa aaactacact tctatcgtcc ctctacgatt      1560
     tcacaccttc ttttcacaca tccttataaa ttaattagat tcttctcttt tctctccttc      1620
     ctctctgtct tctcttcttt ttttcaatga aacctctctt catttataag taacccaaca      1680
     aaaaaataaa attatctccc tcttatttct tctcttcacg tcacaaagac aattcgattc      1740
     caaataatgg accgacgtaa ccctttccaa catcaccacc accaccatca gcttcatcat      1800
     cacttgatcc aacagcaaca gcttcctccg ccgccgctga gcaccacggc gacgatggat      1860
     cccggcggag gaggaggagg tggggagaga atcccacagt ggagcataga ggagacaaag      1920
     gagcttttgg ctataagaga agaacttgat caaactttca tggagaccaa acgtaataag      1980
     cttctttggg aagtcgtggc tgctaagatg gccgacaagg gttttgtccg aagcgcagaa      2040
     caatgtaaga gcaagtggaa gaacctcgtc accagataca aggttaccct tccactattt      2100
     ataatcctat tgatgattct ctctatatat agtcccgata tatacaccta taaatgttag      2160
     tatgatcatg attacgagta tatacaaact ataattatgt gtatcatgta tttcatcact      2220
     agtttgtgtg gttagactga aattatgcat attgaaatgg atacctagtt tatggtgtat      2280
     gtataggtga actacattat atatacatca attaatgagc ttaacctaat cgcctaggtt      2340
     ttttagatat tgtcctgtca ttaatggtaa cgagctatat aatagaattt tacgcgttta      2400
     ttggtgagct ttcatcatga tattgtctat gttcacattt tgatccgtta taccataata      2460
     tctctctttt tgttcgttga tcacatggta agtaagtaac acaatatgcc ataaaaatat      2520
     aattaccgtt atataacggg tgcataagat ttaataagaa ccgttactga tgaacacatg      2580
     aagatagttg aaaaagtcta tgacgacgac tttatttaag gtaaaagaaa cgtgatatag      2640
     atgatgaaca tgtgtttttg ttttggtatg atatatgatt tcgagttaag atagttggtt      2700
     agctaaaata ttttgcgtcg gtactattac gtgtttacat ataattgttt atataacata      2760
     atgaatattc atgggacagg cgtgtgagac cactgagcca gatgctatta ggcagcagtt      2820
     cccattctac aatgagattc agtcgatttt tgaagcaaga atgcaaagaa tgctgtggtc      2880
     agaagccaca gaaccaagca cttcctcgaa gagaaaacat catcaatttt catctgatga      2940
     tgaagaagaa gaagttgacg aaccaaatca agatatcaac gaggaattat tgtctttagt      3000
     agagacacag aaaagagaga cagaagtgat tactactagt acttcgacca atccaagaaa      3060
     acgtgcaaaa aaaggaaaag gcgttgcgag tggtacgaaa gctgaaactg cgggtaatac      3120
     actaaaagat atattggagg agtttatgag gcaaacggtg aagatggaga aggaatggag      3180
     agatgcatgg gagatgaagg agatagagag ggagaagaga gagaaagagt ggcggaggag      3240
     aatggcggag ctagaggagg aaagagccgc cacagaaagg aggtggatgg agagagagga      3300
     agagagacgg ttgagagaag aagctagggc tcagaagaga gattctctca tcgatgcttt      3360
     gcttaatagg cttaatagag atcataatga tgatcatcat aatcaaggtt tctaagttct      3420
     cattatttgt gttaagcata agttaattag ctagttaatt tgttaggcaa atcaatttag      3480
     ataatatatc taaattaatg tttgttttat aatatttata tgaactattg aaatttccaa      3540
     aaagaaagat aaatgttcaa attttgatat atgttatcgt ggtatgaaaa tgaatttatc      3600
     cttctaaaaa caaaaaaaat cctggtggag aaaaataaac cttcaatatt agaggaagaa      3660
     aaataaatag agagggagta aaacgagcag gcaattacta aatataatat aaggtaacat      3720
     gtgaattaac taaacgataa gaataagaat taataaatca tttaatagtt tacgtacatg      3780
     cataaaacaa ttgtatagat attaattaga tatgctagtt tgaattatac tgtattgttc      3840
     atagttatag gtgtccaaaa ccaaattggt tgaatacttt tagctacttt attctgttaa      3900
     taagaatgtt tcataacgat taatcaggcg ataaacaaga attaaacaaa agtctttatt      3960
     ccaaaacttt caattcacat ttgtcccaca ttacttcacc ggcgttattt gtgtgtgata      4020
     tataaaactt attttgttca taagtaaatt gtaaagaaag aatttgttat ttttattctt      4080
     ttcttctctg tgcaagacag ctaccaacag ataaaaatac cgaaaacatg aaaccgtgtt      4140
     ataacgcgtt cacactaata tatcgcgttc atttttaaaa acacgtatta ctaatacgta      4200
     ttactaatac gccgcgtcag ctcatcgcta tagagccgtg tgaccactct gtgaggtcac      4260
     cagttcgaat acaagacctt caatatttac cactttttcg ttggcaaaaa aatagtttat      4320
     gactaaatga aataattata attcgaaact taaataattt agagtgggaa aatgttcttg      4380
     aattttacat gtgaaccccc caaaaaaaac acagaaaagt acaaaaaaac gtcaaagaag      4440
     taacgttaga aggagaccat gatttgcatg tgaaatagac ataaaggaga cagtacgtat      4500
     ttcgaagtta cggagctcc                                                   4519
//

If you have problems or comments...

PBIL Back to PBIL home page