(data stored in SCRATCH zone)

EMBL: AF216962

ID   AF216962; SV 1; linear; mRNA; STD; HUM; 3327 BP.
XX
AC   AF216962;
XX
DT   20-JUL-2000 (Rel. 64, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens ancient conserved domain protein 2 (ACDP2) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3327
RA   Wang C., Shi J., Yang P., Li Q., She J.;
RT   "Identification of a novel gene family (ACDP) conserved from C. elegans to
RT   human, molecular characterization of ACDP2, ACDP3 and ACDP4";
RL   Unpublished.
XX
RN   [2]
RP   1-3327
RA   Wang C., Shi J., Yang P., Li Q., She J.;
RT   ;
RL   Submitted (17-DEC-1999) to the INSDC.
RL   Pathology and Laboratory Medicine, University of Florida, 1600 SW Archer
RL   Road, Gainesville, FL 32610, USA
XX
DR   MD5; 165f21e3a06eb3e8108685d98fafb413.
DR   Ensembl-Gn; ENSG00000148842; homo_sapiens.
DR   Ensembl-Tr; ENST00000369875; homo_sapiens.
DR   Ensembl-Tr; ENST00000369878; homo_sapiens.
DR   Ensembl-Tr; ENST00000433628; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3327
FT                   /organism="Homo sapiens"
FT                   /chromosome="10"
FT                   /map="between WI-6750 and WI-8488"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetus"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        101..2002
FT                   /codon_start=1
FT                   /gene="ACDP2"
FT                   /product="ancient conserved domain protein 2"
FT                   /db_xref="GOA:Q9H8M5"
FT                   /db_xref="H-InvDB:HIT000074155.14"
FT                   /db_xref="HGNC:HGNC:103"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="PDB:4IY0"
FT                   /db_xref="PDB:4IY2"
FT                   /db_xref="PDB:4IY4"
FT                   /db_xref="PDB:4IYS"
FT                   /db_xref="PDB:6DJ3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9H8M5"
FT                   /protein_id="AAF86374.1"
FT                   /translation="MIVGEEKKFLLPFWLQVIFISLLLCLSGMFSGLNLGLMALDPMEL
FT                   RIVQNCGTEKEKNYAKRIEPVRRQGNYLLCSLLLGNVLVNTTLTILLDDIAGSGLVAVV
FT                   VSTIGIVIFGEIVPQAICSRHGLAVGANTIFLTKFFMMMTFPASYPVSKLLDCVLGQEI
FT                   GTVYNREKLLEMLRVTDPYNDLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAI
FT                   LDFNTMSEIMESGYTRIPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLH
FT                   FVFNDTKLDAMLEEFKKGKSHLAIVQRVNNEGEGDPFYEVLGIVTLEDVIEEIIKSEIL
FT                   DETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQLLLAMHRFLATEVEAFSP
FT                   SQMSEKILLRLLKHPNVIQELKYDEKNKKAPEYYLYQRNKPVDYFVLILQGKVEVEAGK
FT                   EGMKFEASAFSYYGVMALTASPVPLSLSRTFVVSRTELLAAGSPGENKSPPRPCGLNHS
FT                   DSLSRSDRIDAVTPTLGSSNNQLNSSLLQVYIPDYSVRALSDLQFVKISRQQYQNALMA
FT                   SRMDKTPQSSDSENTKIELTLTELHDGLPDETANLLNEQNCVTHSKANHSLHNEGAI"
XX
SQ   Sequence 3327 BP; 798 A; 933 C; 833 G; 763 T; 0 other;
     tggcgccgtc gggggcaagg gtggctcggg ggtggccggg ctcccgccgc ccccgtgggc        60
     cgagaccacc tggatttacc acgacggcga ggacaccaag atgatcgtag gcgaagagaa       120
     gaagttcctg ctgcccttct ggctgcaggt gatcttcatt tcgctgctgc tgtgcctgtc       180
     gggcatgttc agcggcctca acctggggct catggccctg gacccgatgg agctgcgcat       240
     cgtgcagaac tgcggcacgg agaaggagaa gaattacgcc aagcgcatcg agccggtgcg       300
     caggcagggc aactacctgc tgtgctcact gctgctgggc aacgtgctgg tcaacaccac       360
     gctcaccatc ctgctcgacg acatcgccgg ctcgggcctc gtggccgtgg tagtctccac       420
     catcggtatc gtcatcttcg gagagatcgt gccccaggcc atctgctccc ggcatggcct       480
     ggctgtgggg gccaacacca tcttcctcac caagtttttc atgatgatga ccttccccgc       540
     ttcctacccg gtcagcaagc tgctggactg cgtcctgggc caggagatag gcaccgtcta       600
     taaccgggaa aaactgctgg agatgctccg ggtcaccgat ccctacaacg acctcgttaa       660
     ggaggagctg aacatcatcc aaggggcgct ggagctccgc accaagacgg tggaggacgt       720
     gatgacccca ctccgggact gcttcatgat caccggcgaa gccatcctgg acttcaacac       780
     catgtctgag atcatggaga gcggctacac ccgcattcca gtgtttgaag gggagcgctc       840
     caatatcgtg gacctgctgt ttgtcaaaga cttggccttc gtggatcccg atgactgtac       900
     ccccctgaaa accatcacca aattttataa ccaccccttg cactttgttt tcaatgacac       960
     caagttggac gctatgctgg aagaatttaa gaaaggtaaa tctcacctgg ctatcgtgca      1020
     gcgggtaaac aatgagggag aaggggatcc attttatgaa gttctgggaa tcgtcacctt      1080
     agaagatgtg attgaagaaa tcatcaaatc tgagattctt gatgaaacag atttatacac      1140
     tgacaacaga acgaaaaaga aagtggctca ccgggaacga aagcaagatt tttctgcctt      1200
     taagcagaca gacagtgaga tgaaggttaa aatatcacca cagctcctcc tggccatgca      1260
     ccgtttccta gcaacagaag tagaagcatt tagcccatcc cagatgtcag agaagatcct      1320
     tctaaggctg ctaaagcacc ccaatgtcat ccaggaactg aaatatgatg agaagaacaa      1380
     gaaagccccc gaatactacc tctaccagcg caacaagcca gtagactact tcgttctcat      1440
     tctgcagggg aaagtggaag ttgaagctgg gaaagaaggt atgaagtttg aagcgagcgc      1500
     cttctcatac tatggcgtga tggccctgac agcctctcca gttcctttgt ccctgtctcg      1560
     tacctttgtt gtcagcagaa cagagttgtt agcagcaggt tctccaggtg aaaataagtc      1620
     ccctcctcgc ccatgtggct tgaatcactc agactctctc agtcgaagcg accggattga      1680
     cgccgtcaca ccaacactgg ggagcagcaa taaccagctc aattcttcgc tcctccaagt      1740
     ctacatcccc gattactcgg tgcgagccct ttcggatctg cagtttgtta agatctcaag      1800
     acagcaatac caaaatgcct tgatggcatc ccggatggac aaaacccccc agtcttcaga      1860
     cagtgaaaac actaaaatcg aattgactct tacggagctg catgacgggt tgccagacga      1920
     gacagccaac ctgctcaacg aacagaactg tgtgacgcac agtaaggcca accacagcct      1980
     gcacaacgaa ggcgccatct aggccgcgct ggctgcaccc gcccaggccc gcacccgccc      2040
     agtcccgagg gcccggccct gtctgcccat gacttcactg gtgtgagctt gtccgccatg      2100
     ctgtaccctg caacatcctg agaccaaaga ccttgtgccc ttcccaggag ccgcggagga      2160
     ggacagtgag ggaggaatgg aaacgagaga tgtgaagttg gcagccgggg catggcgttc      2220
     aagattttgg agatgaactt gattccgccc aaatagaatc atgtttattt tttcagctct      2280
     cccttttatc attattcaca ctcctctgcc ctcgatttgc atgaagttga aaattgttgc      2340
     gatttatttt ttcaagagat catgttttta aagtgtcttt tgcagagttt taagttgttc      2400
     tgtctgaact ctgctgtgat cccatgatgt gaccctgatg ggctggactt gcccctccgg      2460
     tagccttcct tggccctccc agcgaggggc acccttcctc tgtgccccag tgggcatcac      2520
     cgtcgatctc gctggctgaa tgaagaagac cgtgttactg cagaacctgc caagtctgtc      2580
     atcactgtgg ggtgtagcct gcctcagagg gacctgcaat cacctctctg agctcagtgg      2640
     tattttgaga atttaatgtt taactgtacc cctttccctc aggaagattt aacatttgct      2700
     tgggaatgtg attttgctcc caccctaagg aatttttatc accaaaatga atgttaatga      2760
     atttaaaacc catggtttat cattggcaag aggcaagttg acttcatcct gtcattccag      2820
     cctggggtct gccagccagc cctcctcccc gacccagcgc ctaagctcac agagtgtcgt      2880
     cgcccacctc cctgggtcct tgctcttgtt aacccaagat gctgctacac agatgccaaa      2940
     tgggaaatct tccacagggc tttttcagta aacacgtgat gtggagtgca agctcctccc      3000
     cttcccacta gaacatactt taacagaaaa cgagtcggac cttctagctg cactctgtac      3060
     tgtgtgccga gaaggcattt ctagacccgt gtttttaaag gagggaactt tggggattgc      3120
     cagcccctgc tcctcctccc agggagccaa ctgtccctcc tcccctgtcc ctgggcccat      3180
     ggggcccggc agtggctgtg tcccctgcct gagggctctg tgcctcctgc ctcagatgcg      3240
     gcctgtgcca gagaggctgc ctgtacagcc agggtcagtt tggccccaaa cagggattca      3300
     gaaaccaaaa aaaaaaaaaa aaaaaaa                                          3327
//

If you have problems or comments...

PBIL Back to PBIL home page