(data stored in ACNUC13479 zone)

EMBL: AF224700

ID   AF224700; SV 1; linear; mRNA; STD; PLN; 930 BP.
XX
AC   AF224700;
XX
DT   02-APR-2001 (Rel. 67, Created)
DT   02-APR-2001 (Rel. 67, Last updated, Version 1)
XX
DE   Arabidopsis thaliana WRKY DNA-binding protein 62 (WRKY62) mRNA, partial
DE   cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-930
RA   Chen C., Yu D., Du L., Fan B., Chen Z.;
RT   "Identification of pathogen- and salicylic acid-induced WRKY DNA-binding
RT   activities and genes encoding WRKY DNA-binding proteins in Arabidopsis";
RL   Unpublished.
XX
RN   [2]
RP   1-930
RA   Chen C., Yu D., Du L., Fan B., Chen Z.;
RT   ;
RL   Submitted (14-JAN-2000) to the INSDC.
RL   Microbiology, Molecular Biology and Biochemistry, University of Idaho,
RL   Moscow, ID 83844, USA
XX
DR   MD5; 730c3dff479ddb6c524201bae9503ce9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        <1..860
FT                   /codon_start=3
FT                   /gene="WRKY62"
FT                   /product="WRKY DNA-binding protein 62"
FT                   /note="DNA-binding protein"
FT                   /db_xref="GOA:Q9LZV6"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="InterPro:IPR036576"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV6"
FT                   /protein_id="AAK28310.1"
FT                   /translation="RPRANSARGIIISIYSKKKQKKMNSCQQKAMEKLLHGHGCANQLL
FT                   IMDQTESDSSMEREDLAKSVLHCFSDALSILIDTNDHQDDQSNNSSPQDSSPVLESSRK
FT                   PLHKRGRKTSMAESSDYHRHESSTPIYHDGFLWRKYGQKQIKESEYQRSYYKCAYTKDQ
FT                   NCEAKKQVQKIQHNPPLYSTTYLGQHICQLHQAYATFPIDTSDFEEHEGSHMIRFGHPN
FT                   ISFSSSTXNLRQHQNHQDRIKDEYMKPVIAEDWSPSQWMSSEVALAVEAFEFNPFWASH
FT                   DLSS"
XX
SQ   Sequence 930 BP; 294 A; 250 C; 179 G; 206 T; 1 other;
     cgaggcctcg tgcgaattcg gcacgaggaa taattataag tatttactca aaaaaaaaac        60
     aaaaaaagat gaactcttgc caacaaaagg ctatggagaa gttgcttcac gggcatgggt       120
     gcgccaacca gctgctcatc atggaccaga ccgagtcaga ctcgtccatg gaaagggagg       180
     atttggccaa gtccgtcctc cattgtttct cagatgcgct ctccatcttg atcgatacta       240
     atgaccacca agacgatcaa tccaataact catctcctca ggactcttct cctgtgcttg       300
     agagctccag gaaaccactt cacaagaggg gaagaaagac atctatggca gagagctcag       360
     actaccatag acacgaatct tcaaccccga tctaccacga cggcttcctc tggaggaaat       420
     acggacaaaa gcagatcaaa gaatctgagt accaaaggag ttactacaag tgtgcctaca       480
     ccaaggacca gaactgtgaa gcaaagaagc aggttcaaaa gatccaacac aatcctccat       540
     tgtactcaac cacttacttg ggccagcaca tatgccagct tcatcaagct tatgcaactt       600
     tccccattga cacatctgac ttcgaagagc acgaggggtc ccacatgatc cgattcggtc       660
     accccaacat cagcttctcc tcctccacct ntaacctccg ccaacatcag aatcatcagg       720
     atcgcatcaa agatgaatac atgaaaccgg tgatagcaga agattggtct ccatcccagt       780
     ggatgtcgtc cgaggttgcc ctcgccgtgg aggctttcga gtttaatcct ttctgggcat       840
     ctcacgactt atcatcatga cactatatcc ctcagctcta tcatcataca tatatagctt       900
     ctttaatcct aaaaaaaaaa aaaaaaaaaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page