(data stored in SCRATCH zone)

EMBL: AF230490

ID   AF230490; SV 1; linear; genomic DNA; STD; PRO; 1407 BP.
XX
AC   AF230490;
XX
DT   10-JUL-2000 (Rel. 64, Created)
DT   10-JUL-2000 (Rel. 64, Last updated, Version 1)
XX
DE   Streptomyces coelicolor A3(2) F58r (f58r) gene, partial cds; F58a (f58a)
DE   gene, complete cds; and F58b (f58b) gene, partial cds.
XX
KW   .
XX
OS   Streptomyces coelicolor A3(2)
OC   Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
OC   Streptomyces; Streptomyces albidoflavus group.
XX
RN   [1]
RP   1-1407
RA   Kormanec J., Sevcikova B., Homerova D.;
RT   ;
RL   Submitted (02-FEB-2000) to the INSDC.
RL   Gene Expression, Institute of Molecular Biology, Slovak Academy of
RL   Sciences, Dubravska 21, Bratislava 84251, Slovak Republic
XX
DR   MD5; eac97287cf06f845fd5b616b2a5a9617.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1407
FT                   /organism="Streptomyces coelicolor A3(2)"
FT                   /strain="M145"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:100226"
FT   CDS_pept        complement(<1..447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="f58r"
FT                   /product="F58r"
FT                   /note="similar to several regulatory proteins"
FT                   /db_xref="GOA:Q9KIL9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KIL9"
FT                   /protein_id="AAF82061.1"
FT                   /translation="MGGGVTAIEQTEAVRPRGTRLPRRARRNQLLGAAQEVFVAQGYHA
FT                   AAMDDIAERAGVSKPVLYQHFPGKLDLYLALLDQHCEALIQSVRSALASTSDNKQRVRA
FT                   TMDAYFAYVEDDGGAFRLVFESDLTNEPAVRERVDKVTNECAEAI"
FT   regulatory      562..567
FT                   /note="putative sigma factor F dependent promoter; similar
FT                   to Bacillus subtilis SigB dependent promoter"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      582..587
FT                   /note="putative sigma factor F dependent promoter; similar
FT                   to Bacillus subtilis SigB dependent promoter"
FT                   /regulatory_class="minus_10_signal"
FT   mRNA            598..>1407
FT   CDS_pept        complement(610..837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="f58a"
FT                   /product="F58a"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KIL8"
FT                   /protein_id="AAF82062.1"
FT                   /translation="MTVDPTDPETFDDEAQAPDPEDRDVEAPDADAAEQRADVGQERDA
FT                   PLTGVEPDRADEADLAEQARVVPHDEDDYR"
FT   CDS_pept        1065..>1407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="f58b"
FT                   /product="F58b"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KIL7"
FT                   /protein_id="AAF82063.1"
FT                   /translation="MPSTEPPSVPPANALPKVTAVKVADGERLRSVHLPGITLTVRSRR
FT                   PAREGLPPALYVHGLGGSSQNWSALMPLLDGVVHSEALDLPGFGDSPPPDDGDYSITSH
FT                   ARAVVRHLDA"
XX
SQ   Sequence 1407 BP; 178 A; 516 C; 479 G; 234 T; 0 other;
     gatcgcctcc gcgcactcgt tcgtcacctt gtccacgcgc tcgcgcacgg cgggctcgtt        60
     ggtcaggtcc gactcgaaga ccaggcggaa ggcaccgccg tcgtcctcga cgtaggcgaa       120
     gtacgcgtcc atcgtcgccc ggacgcgctg cttgttgtcg gaggtcgacg ccagcgcgct       180
     gcgcacggac tggatcagtg cctcgcagtg ctggtccagc agggcgaggt agaggtcgag       240
     cttgccgggg aagtgctggt agagcaccgg cttgctgacg ccggctcgct cggcgatgtc       300
     gtccatcgcg gccgcgtggt agccctgggc cacgaacact tcctgtgcgg cgcccagcag       360
     ctggttgcgt cgggctcggc ggggaaggcg tgtgccccgc gggcgtaccg cctctgtctg       420
     ctcgatggct gtcacgccgc ctcccatagt cgtcctcgtg cggtgtgcgc cgcgtcgaca       480
     tcgtactttt cggtaaccgt ggtgtgtgtg ctgcgagcgc agaatttcac ggaccggacg       540
     gcggcgaaag ccgcacaaca ggtttcaaaa ggagccagac cgggcaaaga tcggcctccc       600
     ttccggtgtt cagcggtagt cgtcctcgtc gtgcgggacg acccgggcct gctcggccag       660
     gtcggcctcg tcggcgcggt ccggctctac gccggtcagc ggcgcgtcgc gctcctgccc       720
     gacgtccgcc cgctgctcgg cggcgtcggc gtcgggcgcc tcgacgtcgc ggtcctccgg       780
     atccggtgcc tgcgcctcgt cgtcgaaggt ctcggggtcg gtcgggtcga cggtcatgat       840
     gggctccctt cctacggacg tccccggggt gcaggggtca cacgcgggtg cccacttccc       900
     gagcctagga gacacccgat ccggacgcca tgcgtcgccg gtcccggtct tgcgcgcccg       960
     cttcccgcgc cgacggcatc cgtacccggc cgacgcgccg ccgcagcacc gcttgtgacg      1020
     gcgaacacat gaaccactgt gtgatcatct cgtaatattg ccgcatgcct tcgaccgagc      1080
     cgccgtccgt gccgcccgcc aacgcgctgc cgaaggtcac ggccgtcaag gtcgcggacg      1140
     gggagcggct caggtcggtc cacctccccg gcatcaccct gacggtgcgg tcgagacggc      1200
     ccgcccgcga gggactgccg cccgccctct acgtccacgg cctcggcggc tcctcgcaga      1260
     actggtcggc gctcatgccg ctgctggacg gcgtcgtcca cagcgaggcc ctcgacctgc      1320
     ccggcttcgg cgactccccg ccgccggacg acggcgacta ctcgatcacg agccacgcgc      1380
     gcgcggtcgt ccgccacctc gacgcgt                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page