(data stored in ACNUC15324 zone)

EMBL: AF235006

ID   AF235006; SV 1; linear; mRNA; STD; MUS; 1199 BP.
XX
AC   AF235006;
XX
DT   15-MAY-2001 (Rel. 67, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus melanoma differentiation associated gene-7 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1199
RA   Madireddi M.T., Lin J., Su Z., Shay J.W., Huberman E., Fisher P.B.;
RT   "Genomic Structure, Chromosomal Localization and Expression of Melanoma
RT   Differentiation Associated Gene-7 (mda-7): Potential Relationship with
RT   Cellular Senescence";
RL   Unpublished.
XX
RN   [2]
RP   1-1199
RA   Madireddi M.T., Fisher P.B.;
RT   ;
RL   Submitted (15-FEB-2000) to the INSDC.
RL   Urology, Columbia University, 630 West, 168th Street, BB.1505, New York, NY
RL   10032, USA
XX
DR   MD5; 94bc75bc8e54d8c0642fd12f14b2a487.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1199
FT                   /organism="Mus musculus"
FT                   /strain="129/SvJ"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        256..801
FT                   /codon_start=1
FT                   /product="melanoma differentiation associated gene-7"
FT                   /note="MDA-7; similar to Rattus norvegicus gene c49a"
FT                   /db_xref="GOA:Q925S4"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR020423"
FT                   /db_xref="InterPro:IPR020443"
FT                   /db_xref="InterPro:IPR020444"
FT                   /db_xref="MGI:MGI:2135548"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q925S4"
FT                   /protein_id="AAK52590.1"
FT                   /translation="MSWGLQILPCLSLILLLWNQVPGLEGQEFRSGSCQVTGVVLPELW
FT                   EAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIA
FT                   KFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVK
FT                   AFGEVDILLTWMQKFYHL"
XX
SQ   Sequence 1199 BP; 306 A; 295 C; 275 G; 323 T; 0 other;
     tatcaggcga gacgtttgtt tggtcctatg gtagtctcaa agcagagtgc atggtatcat        60
     gtggcaggaa ggcacggaca aagctgagct gaagtggttt tcacaaagta cccactccaa       120
     tgcatacatt catgggtttg tttaagaggg cagagatctg gtaacagatc tgcgtgtaag       180
     ttccgagtca gaatttgact tcagggtaaa gccttccttt cttcagcagg agcactggcc       240
     ctttcttcaa cacagatgag ttggggacta cagattctcc cctgcctgag cctaatcctt       300
     cttctttgga accaagtgcc agggcttgag ggtcaagagt tccgatcggg gtcttgccaa       360
     gtgacagggg tggttctccc agaactgtgg gaggccttct ggactgtgaa gaacactgtg       420
     caaactcagg atgacatcac aagcatccgg ctgttgaagc cgcaggttct gcggaatgtc       480
     tcgggtgctg agagctgtta ccttgcccac agcctgctga agttctactt gaacactgtt       540
     ttcaagaact accacagcaa aatagccaaa ttcaaggtct tgaggtcatt ctccactctg       600
     gccaacaact tcatagtcat catgtcacaa ctacagccca gtaaggacaa ttccatgctt       660
     cccattagtg agagtgcaca ccagcggttt ttgctgttcc gcagagcatt caaacagttg       720
     gatacagaag tcgctttggt gaaagccttt ggggaagtgg acattctcct gacctggatg       780
     cagaaattct accatctctg actgctgatt ggataacttc ctcctttgct ctccatgcca       840
     tttcaaggca ttgtgtacat ccctgctgtc ctcaaggcac ttcagaccct tggccatcca       900
     ccccgttgtt ggctcaggct tttcctcaga cctcactctt cagtccaaat gacagccata       960
     gatggcacct ttggatgctc cgactgaccc acaaagtaga tttgcatatt tattacagcc      1020
     ctattaaatt attgtcacct tccctggaaa ccgtatttat ttgtgagacc agaagttcca      1080
     tgaaagcatc agaatttagt gccccatgcc tcctcctcac ttcctgtgat ctggctcagc      1140
     atgggggcag tggatggttg ctcagtaaat atttaaaatg gaaaaaaaaa aaaaaaaaa       1199
//

If you have problems or comments...

PBIL Back to PBIL home page