(data stored in SCRATCH zone)

EMBL: AF252284

ID   AF252284; SV 1; linear; mRNA; STD; HUM; 2913 BP.
XX
AC   AF252284;
XX
DT   04-MAY-2000 (Rel. 63, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens transcription specificity factor Sp1 mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2913
RA   Haggart M.H., Ladurner A.G.;
RT   ;
RL   Submitted (04-APR-2000) to the INSDC.
RL   Molecular and Cell Biology, University of California at Berkeley, 401
RL   Barker Hall, No. 3204, Berkeley, CA 94720-3204, USA
XX
DR   MD5; 53c0f01d62499a9d6d6f6a3a5f205607.
DR   Ensembl-Gn; ENSG00000185591; homo_sapiens.
DR   Ensembl-Tr; ENST00000327443; homo_sapiens.
DR   Ensembl-Tr; ENST00000426431; homo_sapiens.
DR   EuropePMC; PMC2663287; 19193796.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2913
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_type="HeLa"
FT                   /tissue_type="cervical carcinoma"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..2349
FT                   /codon_start=1
FT                   /product="transcription specificity factor Sp1"
FT                   /note="transcriptional activator protein; ubiquitous
FT                   enhancer binding protein; binds GC-boxes"
FT                   /db_xref="GOA:P08047"
FT                   /db_xref="H-InvDB:HIT000075087.13"
FT                   /db_xref="HGNC:HGNC:11205"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PDB:1SP1"
FT                   /db_xref="PDB:1SP2"
FT                   /db_xref="PDB:1VA1"
FT                   /db_xref="PDB:1VA2"
FT                   /db_xref="PDB:1VA3"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08047"
FT                   /protein_id="AAF67726.1"
FT                   /translation="QDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSS
FT                   TGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGW
FT                   QIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPG
FT                   VMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNII
FT                   AAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAV
FT                   TISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTT
FT                   SGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQ
FT                   PQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQ
FT                   VSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNA
FT                   AQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDT
FT                   AGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYG
FT                   KTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMR
FT                   SDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICP
FT                   EGIARLANSGINVMQVADLQSINISGNGF"
XX
SQ   Sequence 2913 BP; 790 A; 783 C; 712 G; 628 T; 0 other;
     caagatcact ccatggatga aatgacagct gtggtgaaaa ttgaaaaagg agttggtggc        60
     aataatgggg gcaatggtaa tggtggtggt gccttttcac aggctcgaag tagcagcaca       120
     ggcagtagca gcagcactgg aggaggaggg caggagtccc agccatcccc tttggctctg       180
     ctggcagcaa cttgcagcag aattgagtca cccaatgaga acagcaacaa ctcccagggc       240
     ccgagtcagt cagggggaac aggtgagctt gacctcacag ccacacaact ttcacagggt       300
     gccaatggct ggcagatcat ctcttcctcc tctggggcta cccctacctc aaaggaacag       360
     agtggcagca gtaccaatgg cagcaatggc agtgagtctt ccaagaatcg cacagtctct       420
     ggtgggcagt atgttgtggc tgccgctccc aacttacaga accagcaagt tctgacagga       480
     ctacctggag tgatgcctaa tattcagtat caagtaatcc cacagttcca gaccgttgat       540
     gggcaacagc tgcagtttgc tgccactggg gcccaagtgc agcaggatgg ttctggtcaa       600
     atacagatca taccaggtgc aaaccaacag attatcacaa atcgaggaag tggaggcaac       660
     atcattgctg ctatgccaaa cctactccag caggctgtcc ccctccaagg cctggctaat       720
     aatgtactct caggacagac tcagtatgtg accaatgtac cagtggccct gaatgggaac       780
     atcaccttgc tacctgtcaa cagcgtttct gcagctacct tgactcccag ctctcaggca       840
     gtcacgatca gcagctctgg gtcccaggag agtggctcac agcctgtcac ctcagggact       900
     accatcagtt ctgccagctt ggtatcatca caagccagtt ccagctcctt tttcaccaat       960
     gccaatagct actcaactac tactaccacc agcaacatgg gaattatgaa ctttactacc      1020
     agtggatcat cagggaccaa ctctcaaggc cagacacccc agagggtcag tgggctacag      1080
     gggtctgatg ctctgaacat ccagcaaaac cagacatctg gaggctcatt gcaagcaggc      1140
     cagcaaaaag aaggagagca aaaccagcag acacagcagc aacaaattct tatccagcct      1200
     cagctagttc aagggggaca ggccctccag gccctccaag cagcaccatt gtcagggcag      1260
     acctttacaa ctcaagccat ctcccaggaa accctccaga acctccagct tcaggctgtt      1320
     ccaaactctg gtcccatcat catccggaca ccaacagtgg ggcccaatgg acaggtcagt      1380
     tggcagactc tacagctgca gaacctccaa gttcagaacc cacaagccca aacaatcacc      1440
     ttagccccaa tgcagggtgt ttccttgggg cagaccagca gcagcaacac cactctcaca      1500
     cccattgcct cagctgcttc cattcctgct ggcacagtca ctgtgaatgc tgctcaactc      1560
     tcctccatgc caggcctcca gaccattaac ctcagtgcat tgggtacttc aggaatccag      1620
     gtgcacccaa ttcaaggcct gccgttggct atagcaaatg ccccaggtga tcatggagct      1680
     cagcttggtc tccatggggc tggtggtgat ggaatacatg atgacacagc aggtggagag      1740
     gaaggagaaa acagcccaga tgcccaaccc caagccggtc ggaggacccg gcgggaagca      1800
     tgcacctgcc cctactgtaa agacagtgaa ggaaggggct cgggggatcc tggcaaaaag      1860
     aaacagcata tttgccacat ccaaggctgt gggaaagtgt atggcaagac ctctcacctg      1920
     cgggcacact tgcgctggca tacaggcgag aggccattta tgtgtacctg gtcatactgt      1980
     gggaaacgct tcacacgttc ggatgagcta cagaggcaca aacgtacaca cacaggtgag      2040
     aagaaatttg cctgccctga gtgtcctaag cgcttcatga ggagtgacca cctgtcaaaa      2100
     catatcaaga cccaccagaa taagaaggga ggcccaggtg tagctctgag tgtgggcact      2160
     ttgcccctgg acagtggggc aggttcagaa ggcagtggca ctgccactcc ttcagccctt      2220
     attaccacca atatggtagc catggaggcc atctgtccag agggcattgc ccgtcttgcc      2280
     aacagtggca tcaacgtcat gcaggtggca gatctgcagt ccattaatat cagtggcaat      2340
     ggcttctgag atcaggcacc cggggccaga gacatatggg ccatacccct taaccccggg      2400
     atgcaaggta gcatgggtcc aagagacatg gaagagagag ccatgaagca ttaaaatgca      2460
     tggtgttgag aagaatcagg agagggatac aagagaggag atggggtccc ggcacccatc      2520
     tgtatcatca gtgcctcttt gaaggtggga aacattagtg aaaattctgt tggtgccacg      2580
     ctttgatgag catttgtttg accccagttt cttcttacac ttcttacccc agcctaccct      2640
     tcctgcattt ctcttctcag ctcttccatg atggattccc ccccctttcc taaagccatc      2700
     atgccttgat aaatatatat gatcattgaa atacttttta acaaaaaaca gattctatat      2760
     tattatatat atatatatat ataaagatat atagagatgc attcacaggg ttggctggag      2820
     aggaagacca ttctgtgacc aaaatacctt ggtcattttt tttatattgc cttatttccc      2880
     tatggctgag ccttgttgtg acacatcaag ctt                                   2913
//

If you have problems or comments...

PBIL Back to PBIL home page