(data stored in ACNUC15324 zone)

EMBL: AF269251

ID   AF269251; SV 1; linear; mRNA; STD; ROD; 1177 BP.
XX
AC   AF269251;
XX
DT   22-JUN-2000 (Rel. 64, Created)
DT   09-AUG-2000 (Rel. 64, Last updated, Version 2)
XX
DE   Rattus norvegicus secreted protein Mob-5 (mob-5) mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1177
RX   DOI; 10.1074/jbc.M001958200.
RX   PUBMED; 10825166.
RA   Zhang R., Tan Z., Liang P.;
RT   "Identification of a novel ligand-receptor pair constitutively activated by
RT   ras oncogenes";
RL   J Biol Chem 275(32):24436-24443(2000).
XX
RN   [2]
RP   1-1177
RA   Liang P.;
RT   ;
RL   Submitted (19-MAY-2000) to the INSDC.
RL   Cell Biology, Vanderbilt-Ingram Cancer Center, 658 MRB II, Nashville, TN
RL   37232, USA
XX
DR   MD5; 0e70d30c3fe4efabe6ead1379a586d18.
DR   Ensembl-Gn; ENSRNOG00000004470; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000006106; rattus_norvegicus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1177
FT                   /organism="Rattus norvegicus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        232..783
FT                   /codon_start=1
FT                   /gene="mob-5"
FT                   /product="secreted protein Mob-5"
FT                   /note="similar to Mda-7"
FT                   /db_xref="GOA:Q9JI24"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR020423"
FT                   /db_xref="InterPro:IPR020444"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI24"
FT                   /protein_id="AAF75553.1"
FT                   /translation="MQTSLRQQILPGLSLILLVLNQVPELQGQEFRFGPCQVTGVVLPE
FT                   LWEAFWTVKNTVKTQDELTSVRLLKPQVLQNVSDAESCYLAHSLLKFYLNTVFKNYHSK
FT                   IVKFKVLKSFSTLANNFLVIMSKLQPSKDNAMLPISDSARRRFLLYHRTFKQLDIEVAL
FT                   AKAFGEVDILLAWMQNFYQL"
XX
SQ   Sequence 1177 BP; 298 A; 315 C; 251 G; 313 T; 0 other;
     cagacccctt atatatggtt ctccaagcct tcctcacctg cacactcttt ttacttttga        60
     aatcatttcc acagtggaga caggtgcttc ctacccacca gaagaccccc taccagtgaa       120
     tgttgacgga gcttgcccaa cttttcgtgc agtaagaaga accagccacc ttcacacagc       180
     agcctccagc gtcacttcag gacctgagca ggagcacggg ccctttcttc aatgcagaca       240
     agcttgagac aacagattct ccccggcctg agcctaatcc ttctcgtttt gaaccaagta       300
     ccagagcttc agggtcaaga gttccgattt gggccttgcc aagtgaccgg ggtggttctc       360
     ccagaactgt gggaggcctt ctggactgtg aagaacactg tgaaaactca ggacgagctc       420
     acaagtgtcc ggctgttgaa accacaggtt ctgcagaatg tctcggatgc cgagagctgt       480
     taccttgccc acagcctgct gaagttctac ttgaacactg ttttcaaaaa ctatcacagc       540
     aaaatagtca aattcaaggt cttgaagtca ttctccactc tggccaacaa ctttttagtc       600
     atcatgtcca aactgcagcc tagtaaggac aatgccatgc ttcccattag tgacagtgca       660
     cgccggcgtt ttttgctgta ccacagaaca ttcaaacagt tggacataga agtggctttg       720
     gcgaaagcct ttggggaagt ggacattctc ctggcctgga tgcagaattt ctaccagctc       780
     tgattgccaa tccggataac ttcctccttt gttctccgtg ccatttcaag gcattgttca       840
     tatccctgtt gtcctcaggg cacttcagac ccttggccat ggacccctgt cgttggctca       900
     ggcttttctt cagacctcac tctttagtcc aaacgacagc catggacagc acctttggat       960
     gctccgactg acccacaacg tggatttgca tatttattac agccctattt aactaatgtc      1020
     actgtttcgg tagaaaccgt atttatttgt gagactggac gttccatgaa agcatcatgc      1080
     cccgtgtttg caccttactt cctgtgagct ggctcaccat gggggcagta gatggttgct      1140
     cagtaaatat ttaaaatgga aaaaaaaaaa aaaaaaa                               1177
//

If you have problems or comments...

PBIL Back to PBIL home page