(data stored in ACNUC7820 zone)

EMBL: AF271035

ID   AF271035; SV 1; linear; genomic DNA; STD; ROD; 801 BP.
XX
AC   AF271035;
XX
DT   09-OCT-2000 (Rel. 65, Created)
DT   26-OCT-2000 (Rel. 65, Last updated, Version 2)
XX
DE   Rattus norvegicus clone rF12r odorant receptor gene, partial cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-801
RX   PUBMED; 11014824.
RA   Branscomb A., Seger J., White R.L.;
RT   "Evolution of odorant receptors expressed in mammalian testes";
RL   Genetics 156(2):785-797(2000).
XX
RN   [2]
RP   1-801
RA   Branscomb A., Seger J., White R.L.;
RT   ;
RL   Submitted (24-MAY-2000) to the INSDC.
RL   Department of Biology, University of Utah, 257 South 1400 East, Salt Lake
RL   City, Utah 84112-0840, USA
XX
DR   MD5; f0f410d78f54985939199bb0f226fb8a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="genomic DNA"
FT                   /clone="rF12r"
FT                   /tissue_type="olfactory epithelium"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        <1..>801
FT                   /codon_start=1
FT                   /product="odorant receptor"
FT                   /note="similar to rF12m and Rattus norvegicus olfactory
FT                   protein encoded by GenBank Accession Number M64381"
FT                   /db_xref="GOA:Q9ERY6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ERY6"
FT                   /protein_id="AAG21308.1"
FT                   /translation="LIFALFLSMYLVTVLGNLLIIMAIITQSHLHTPMYFFLANLSFVD
FT                   ICFTSTTIPKMLVNIYTQSKTITYEDCISQMCVFLVFAELDNFLLAVMAYDRYVAICHP
FT                   LCYTVIVNHRLCILLLLLSWVISIFHAFIQSLIVLQLTFCGDVKIPHFFCELNQLSQLT
FT                   CSDNFPSHLIMNLVPVMLAAISFSGILYSYSKIVSSIHSISTVQGKYKAFSTCASHLSI
FT                   VSLFYSTGLGVYVSSAVVQSSHSAASASVMYTVVTPMLNPXIYSX"
XX
SQ   Sequence 801 BP; 176 A; 215 C; 140 G; 268 T; 2 other;
     ctcatttttg cactattcct gtccatgtac ctggtaacag tgcttgggaa cctgcttatc        60
     attatggcca tcatcacaca gtctcatttg catacaccca tgtacttttt ccttgctaac       120
     ctatcctttg tggacatctg tttcacctcc accaccatcc caaagatgtt ggtaaatata       180
     tacacccaga gcaagaccat cacctatgaa gactgtatta gccagatgtg tgtcttcttg       240
     gttttcgcag aattggacaa ctttctcctg gctgtgatgg cctatgaccg atatgtggct       300
     atctgtcacc cactgtgtta cacagtcatt gtgaaccacc ggctctgtat cctgctgctt       360
     ctgctgtcct gggttatcag cattttccat gccttcatac agagcttaat tgtgctacag       420
     ttgaccttct gtggagatgt gaaaatccct cacttcttct gtgaacttaa tcagctgtcc       480
     caactcacct gttcagacaa ctttccaagt cacctcataa tgaatcttgt acctgttatg       540
     ttggcagcca tttccttcag tggcatcctt tactcttatt ccaagatagt atcctccata       600
     cattctatct ccacagttca ggggaagtac aaggcatttt ctacttgtgc ctctcacctt       660
     tccattgtct ccttatttta tagtacaggc ctcggagtgt acgtcagttc tgctgtggtc       720
     caaagctcac attctgctgc aagtgcttcg gtcatgtata ctgtggtcac ccccatgctg       780
     aaccccttna tttatagtnt a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page