(data stored in ACNUC7820 zone)

EMBL: AF271052

ID   AF271052; SV 1; linear; genomic DNA; STD; ROD; 399 BP.
XX
AC   AF271052;
XX
DT   09-OCT-2000 (Rel. 65, Created)
DT   26-OCT-2000 (Rel. 65, Last updated, Version 2)
XX
DE   Rattus norvegicus clone mT15r odorant receptor gene, partial cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-399
RX   PUBMED; 11014824.
RA   Branscomb A., Seger J., White R.L.;
RT   "Evolution of odorant receptors expressed in mammalian testes";
RL   Genetics 156(2):785-797(2000).
XX
RN   [2]
RP   1-399
RA   Branscomb A., Seger J., White R.L.;
RT   ;
RL   Submitted (24-MAY-2000) to the INSDC.
RL   Department of Biology, University of Utah, 257 South 1400 East, Salt Lake
RL   City, Utah 84112-0840, USA
XX
DR   MD5; 535ff0ee4ae3e0f1999fd3f4f257cc31.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..399
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="genomic DNA"
FT                   /clone="mT15r"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        <1..>399
FT                   /codon_start=1
FT                   /product="odorant receptor"
FT                   /note="similar to mT15m"
FT                   /db_xref="GOA:P35899"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35899"
FT                   /protein_id="AAG21325.1"
FT                   /translation="LCGLLVLGSWVTTALNSLLQSSMALRLSFCTDLKIPHFVCELNQL
FT                   VLLACNDTFPNDMVMYFAAVLLGGGPLAGILYSYSKIVSSIRAISSSQGKYKAFSTCAS
FT                   HLSVVSLFYSTLLGVYLSSSFTQNSHSTA"
XX
SQ   Sequence 399 BP; 85 A; 105 C; 74 G; 135 T; 0 other;
     ctctgtggat tattagtttt ggggtcctgg gtcacaacag cattgaattc cttgctgcaa        60
     agctcaatgg cactgcggct gtccttctgc acagacttga aaattcccca ctttgtttgt       120
     gagcttaatc aactggtact acttgcctgt aatgacacct ttcctaatga catggtgatg       180
     tactttgcag ctgtactgct gggtggtggt ccccttgctg gcatccttta ttcttactct       240
     aagatcgttt cctccatacg cgcaatctca tcatcacagg gaaagtacaa ggcattctcc       300
     acctgtgcat cccacctctc agttgtttca ttattctatt ctacactttt gggtgtgtac       360
     cttagttctt cttttaccca aaactcacac tcaactgca                              399
//

If you have problems or comments...

PBIL Back to PBIL home page