(data stored in ACNUC7820 zone)

EMBL: AF283814

ID   AF283814; SV 1; linear; genomic DNA; STD; MUS; 933 BP.
XX
AC   AF283814;
XX
DT   02-AUG-2000 (Rel. 64, Created)
DT   02-AUG-2000 (Rel. 64, Last updated, Version 1)
XX
DE   Mus musculus M65 odorant receptor gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-933
RA   Feinstein P., Mombaerts P.;
RT   "Odorant Receptor M65, homolog of M64";
RL   Unpublished.
XX
RN   [2]
RP   1-933
RA   Feinstein P., Mombaerts P.;
RT   ;
RL   Submitted (30-JUN-2000) to the INSDC.
RL   The Rockefeller University, 1230 York Ave, NY, NY 10021, USA
XX
DR   MD5; 069f3b9dd0b0d8499202bd6f72a79ac3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..933
FT                   /organism="Mus musculus"
FT                   /strain="129/SvJ"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>933
FT                   /product="M65 odorant receptor"
FT   CDS_pept        1..933
FT                   /codon_start=1
FT                   /product="M65 odorant receptor"
FT                   /db_xref="GOA:Q9JHW3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JHW3"
FT                   /protein_id="AAF91474.1"
FT                   /translation="MESGNRTRRISSFFLLGFSENPHLQFLIFVLFLSMYLVTVLGNLL
FT                   IIMVTITQSPLHTPMYFFLANLSFVDICFTSTTVPKMMVNIQTQSKAITYADCISQMSV
FT                   FLVFGELDNFLLAVMAYDRYVAICHPLYYTVIVNQQLCMLMVLLSWVVSILHAFLQSSI
FT                   VLQLTFCGDVKIPHFFCELNQLSQLTCSDSLSSHLIMHLVPVLLGAISFSSILYSYFKI
FT                   VSSICSISSVQGKYKAFSTCVSHLSIVSLFYSTGLGVYVSSAVVQSSHSSARASVMYTV
FT                   VTPMLNPFIYSLRNKDVKKAVERLLEGKL"
XX
SQ   Sequence 933 BP; 231 A; 228 C; 168 G; 306 T; 0 other;
     atggaatcag gcaacagaac aagaagaatt tcaagttttt ttcttcttgg attttcagaa        60
     aacccacacc ttcaattcct catttttgta ctgttccttt ccatgtacct ggtaacagtg       120
     cttgggaacc tgctcatcat catggtcacc atcacacagt ctcccctgca cacacccatg       180
     tacttcttcc ttgctaacct gtcctttgtg gacatctgtt tcacctccac cactgtccca       240
     aagatgatgg taaatataca gactcaaagc aaggccatta catatgcaga ctgtattagc       300
     cagatgtctg tcttcttggt ttttggagaa ctggacaact ttctcctggc tgtgatggcc       360
     tatgaccgat atgtggctat ctgtcaccca ttgtattaca cagtcattgt taaccaacaa       420
     ctctgtatgc tgatggttct gctgtcctgg gttgttagca tcctacatgc cttcttacag       480
     agctcaattg tactacagtt gaccttttgt ggagatgtaa aaattcccca cttcttctgt       540
     gagcttaacc agctgtctca actcacatgt tcagacagct tatcaagcca cctcataatg       600
     catcttgtac ctgttctatt gggagccatt tccttcagta gtatccttta ctcttatttc       660
     aagatagtgt cctccatatg ttctatctcc tcagttcaag ggaagtacaa ggcattttct       720
     acatgtgtct ctcacctttc cattgtctcc ttattttata gtacaggcct tggagtgtat       780
     gtcagttctg ctgtggtcca aagctctcac tcttctgcaa gagcctctgt gatgtatact       840
     gtggtcaccc cgatgctgaa ccccttcatt tatagtctaa ggaataaaga tgtgaagaaa       900
     gctgtggaaa gactattaga aggaaaactg taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page