(data stored in ACNUC21429 zone)

EMBL: AF293385

ID   AF293385; SV 1; linear; mRNA; STD; HUM; 1875 BP.
XX
AC   AF293385;
XX
DT   30-AUG-2000 (Rel. 64, Created)
DT   01-MAR-2003 (Rel. 74, Last updated, Version 3)
XX
DE   Homo sapiens PLIC-2 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1875
RX   DOI; 10.1016/S1097-2765(00)00040-X.
RX   PUBMED; 10983987.
RA   Kleijnen M.F., Shih A.H., Zhou P., Kumar S., Soccio R.E., Kedersha N.L.,
RA   Gill G., Howley P.M.;
RT   "The hPLIC proteins may provide a link between the ubiquitination machinery
RT   and the proteasome";
RL   Mol. Cell 6(2):409-419(2000).
XX
RN   [2]
RP   1-1875
RA   Kleijnen M.F., Shih A.H., Zhou P., Kumar S., Soccio R.E., Kedersha N.L.,
RA   Gill G., Howley P.M.;
RT   ;
RL   Submitted (04-AUG-2000) to the INSDC.
RL   Pathology, Harvard Medical School, 200 Longwood Avenue, Boston, MA 02115,
RL   USA
XX
DR   MD5; 7e64842c0eae24733494abcef3e005be.
DR   Ensembl-Gn; ENSG00000188021; homo_sapiens.
DR   Ensembl-Tr; ENST00000338222; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1875
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..1875
FT                   /codon_start=1
FT                   /product="PLIC-2"
FT                   /function="role in ubiquitin-dependent proteasomal
FT                   degradation"
FT                   /note="ubiquitin-like type II"
FT                   /db_xref="GOA:Q9UHD9"
FT                   /db_xref="H-InvDB:HIT000076550.12"
FT                   /db_xref="HGNC:HGNC:12509"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR028430"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="PDB:1J8C"
FT                   /db_xref="PDB:2NBV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UHD9"
FT                   /protein_id="AAG02474.1"
FT                   /translation="MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEE
FT                   FAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKS
FT                   QNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTN
FT                   FSELQSQMQQQLMASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEIS
FT                   HLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLN
FT                   AAQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGS
FT                   GSGNSSSNATGNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSL
FT                   SQNPDLAAQMMLNSPLFTANPQLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQI
FT                   QQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIG
FT                   PTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLP
FT                   NPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS"
XX
SQ   Sequence 1875 BP; 493 A; 556 C; 464 G; 362 T; 0 other;
     atggctgaga atggcgagag cagcggcccc ccgcgcccct cccgcggccc tgctgcggcc        60
     caaggctcgg ctgctgcccc ggctgagcct aaaatcatca aagtcacggt gaagactccc       120
     aaagagaaag aggagttcgc ggtgcccgag aacagctcgg ttcagcagtt taaggaagcg       180
     atttcgaaac gcttcaaatc ccaaaccgat cagctagtgc tgatttttgc cggaaaaatc       240
     ttaaaagatc aagatacctt gatccagcat ggcatccatg atgggctgac tgttcacctt       300
     gtcatcaaaa gccagaaccg acctcagggc cagtccacgc agcctagcaa tgccgcggga       360
     actaacacta cctcggcgtc gactcccagg agtaactcca cacctatttc cacaaatagc       420
     aacccgtttg ggttggggag cctgggagga cttgcaggcc ttagcagcct gggcttgagc       480
     tcgaccaact tctctgagct ccagagccag atgcagcagc agcttatggc cagccctgag       540
     atgatgatcc aaataatgga aaatcccttt gttcagagca tgctttcgaa tcccgatctg       600
     atgaggcagc tcattatggc taatccacag atgcagcaat tgattcagag aaacccagaa       660
     atcagtcacc tgctcaacaa cccagacata atgaggcaga cactcgaaat tgccaggaat       720
     ccagccatga tgcaagagat gatgagaaat caagacctgg ctcttagcaa tctagaaagc       780
     atcccaggtg gctataatgc tttacggcgc atgtacactg acattcaaga gccgatgctg       840
     aatgccgcac aagagcagtt tgggggtaat ccatttgcct ccgtggggag tagttcctcc       900
     tctggggaag gtacgcagcc ttcccgcaca gaaaatcgcg atccactacc caatccatgg       960
     gcaccaccgc cagctaccca gagttctgca actaccagca cgaccacaag cactggtagt      1020
     gggtctggca atagttccag caatgctact gggaacaccg ttgctgccgc taattatgtc      1080
     gccagcatct ttagtacccc aggcatgcag agcctgctgc aacagataac tgaaaacccc      1140
     cagctgattc agaatatgct gtcggcgccc tacatgagaa gcatgatgca gtcgctgagc      1200
     cagaatccag atttggctgc acagatgatg ctgaatagcc cgctgtttac tgcaaatcct      1260
     cagctgcagg agcagatgcg gccacagctc ccagccttcc tgcagcagat gcagaatcca      1320
     gacacactat cagccatgtc aaacccaaga gcaatgcagg ctttaatgca gatccagcag      1380
     gggctacaga cattagccac tgaagcacct ggcctgattc cgagcttcac tccaggtgtg      1440
     ggggtggggg tgctgggaac cgctataggc cctgtaggcc cagtcacccc cataggcccc      1500
     ataggcccta tagtcccttt tacccccata ggccccattg ggcccatagg acccactggc      1560
     cctgcagccc cccctggctc caccggctct ggtggcccca cggggcctac tgtgtccagc      1620
     gctgcaccta gtgaaaccac gagtcctaca tcagaatctg gacccaacca gcagttcatt      1680
     cagcaaatgg tgcaggccct ggctggagca aatgctccac agctgccgaa tccagaagtc      1740
     agatttcagc aacaactgga acagctcaac gcaatggggt tcttaaaccg tgaagcaaac      1800
     ttgcaggccc taatagcaac aggaggcgac atcaatgcag ccattgaaag gctgctgggc      1860
     tcccagccat cgtaa                                                       1875
//

If you have problems or comments...

PBIL Back to PBIL home page