(data stored in ACNUC21562 zone)

EMBL: AF295365

ID   AF295365; SV 1; linear; mRNA; STD; MUS; 1809 BP.
XX
AC   AF295365;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus G-protein coupled receptor GPR90 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1809
RX   DOI; 10.1006/jmbi.2001.4520.
RX   PUBMED; 11273702.
RA   Wittenberger T., Schaller H.C., Hellebrand S.;
RT   "An expressed sequence tag (EST) data mining strategy succeeding in the
RT   discovery of new G-protein coupled receptors";
RL   J. Mol. Biol. 307(3):799-813(2001).
XX
RN   [2]
RP   1-1809
RA   Wittenberger T., Schaller C.H., Hellebrand S.;
RT   ;
RL   Submitted (14-AUG-2000) to the INSDC.
RL   ZMNH, Institut fur Entwicklungsneurobiologie, Martinistr. 52, Hamburg
RL   20246, Germany
XX
DR   MD5; 7269d77f1ef06d5704994729813fd207.
DR   Ensembl-Gn; ENSMUSG00000059408; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023151; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023119; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023083; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023119; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022882; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023562; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022396; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022854; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022987; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022957; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023059; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022976; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023588; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022144; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022453; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000075296; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045559; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0045542; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0045494; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045502; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045252; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0045987; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045366; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0045167; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045308; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0045268; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0045395; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045245; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046056; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0044949; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044636; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1809
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        842..1807
FT                   /codon_start=1
FT                   /product="G-protein coupled receptor GPR90"
FT                   /note="orphan receptor"
FT                   /db_xref="GOA:Q99MT8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026221"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:1934134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99MT8"
FT                   /protein_id="AAK01865.1"
FT                   /translation="MEPLAMTLYPLESTQPTRNKTPNETTWSSEHTDDHTYFLVSLVIC
FT                   SLGLAGNGLLIWFLIFCIKRKPFTIYILHLAIADFMVLLCSSIMKLVNTFHIYNMTLES
FT                   YAILFMIFGYNTGLHLLTAISVERCLSVLYPIWYQCQRPKHQSAVACMLLWALSVLVSG
FT                   LENFFCILEVKPQFPECRYVYIFSCILTFLVFVPLMIFSNLILFIQVCCNLKPRQPTKL
FT                   YVIIMTTVILFLVFAMPMKVLLIIGYYSSSLDDSVWDSLPYLNMLSTINCSINPIVYFV
FT                   VGSLRRKRSRKSLKEALQKVFEEKPVVASRENVTQFSLPS"
XX
SQ   Sequence 1809 BP; 447 A; 490 C; 410 G; 462 T; 0 other;
     aagaaccacc gcacagatcc aagtactgac aggaccacaa gtggagccag gccaacatgg        60
     ggaaaagaga aaggagggga aagccccact gagagttttt ctcatccttc agtgggctgc       120
     aaatgtaatc aatcactctt tttggctacg ttattgggtt cttttaccca ccaccttctc       180
     cacctccatt ccttcaaacc ccacagcact gggtaggcaa gaaagaaggt tagaggggaa       240
     aggaggtgtt ggcctcatta ggctacttcc tgctgattag ggaccccgag ttcctacagg       300
     caagtttgat ctccattgtc aggatatcca gtttcttcct ctcatcaact ttgctcacaa       360
     ccacttgaca aaccacaacc agcagcagga ggagagcagc agcctcctcc tttcttgggg       420
     ctgtgtcccc agccacagtt taaatcattt caatgtattg ccatgtatca ctttaaaact       480
     cctaattctg tcacctcgtt ctggtaagaa ctcctagaca taagaaacac agagagcttt       540
     cccagagagc cgtgaccaaa gaggaactgt tgtaggctga ggctgggagt cagccctagt       600
     gttagtagag gggatgtgga catttcagta gcgtctgctg agtggagagc tgacaaaggg       660
     ggaatgagcc agggcatgaa gatgaggaga gagggcgggg gactctggcg tccctgtccc       720
     tcagcatggg agagaagcct ccccatgata caaaaccgtt ctgaggtgca gaacagatgg       780
     cgccggtcac caccttctgt ttctgatcac aggaggccac agagaaagcc atcttcctgg       840
     aatggagcca ttggcaatga ccttgtatcc tctggaatcc acacaaccca ccagaaacaa       900
     aaccccaaat gaaaccacct ggtcttcaga gcatacggat gaccacactt acttcttagt       960
     ctccctggtc atttgttccc tgggactggc tgggaatggc cttttgatat ggttcctaat      1020
     cttctgtatc aagaggaagc cattcaccat ctacatcctc catctcgcca ttgcagactt      1080
     catggtcctc ctctgttcgt ccatcatgaa gctagtgaac acttttcaca tctacaatat      1140
     gaccttagag agctacgcca tcctcttcat gatctttggc tacaacacag ggctccacct      1200
     cctcacggcc atcagcgtag agcggtgcct ctccgtgctt tatccaatct ggtaccagtg      1260
     ccaacgccca aaacaccagt ccgctgtggc ctgtatgctg ctgtgggccc tctctgttct      1320
     cgtgtctggt ttggaaaact tcttctgcat tctggaagtg aagccccaat tcccagaatg      1380
     ccgatacgtg tacatattct cctgtatctt gactttcctg gtcttcgttc ctctcatgat      1440
     cttctctaat ttgatcctct tcatccaagt ctgctgtaac ctgaagccac gtcaaccgac      1500
     caagctctat gtgatcatca tgaccacggt catcctgttt cttgtcttcg ccatgcccat      1560
     gaaggtgttg cttatcatcg gctactattc tagttctctt gatgattctg tatgggactc      1620
     cctcccctac ctgaacatgc tgtccactat aaactgcagc atcaacccaa ttgtctactt      1680
     tgtggtaggc agcctgagga ggaagaggag taggaagtcc ctaaaagaag cactgcagaa      1740
     agtcttcgag gaaaagccag tggtggcctc gagggagaat gtgacacagt tctcgctgcc      1800
     ttcatgacc                                                              1809
//

If you have problems or comments...

PBIL Back to PBIL home page