(data stored in ACNUC1829 zone)

EMBL: AF295377

ID   AF295377; SV 2; linear; mRNA; STD; VRT; 1271 BP.
XX
AC   AF295377;
XX
DT   06-DEC-2000 (Rel. 66, Created)
DT   30-JUL-2018 (Rel. 137, Last updated, Version 5)
XX
DE   Danio rerio Cd81 (cd81) mRNA, complete cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1271
RX   DOI; 10.1016/S0378-1119(00)00503-5.
RX   PUBMED; 11167010.
RA   Yoder J.A., Litman G.W.;
RT   "The zebrafish fth1, slc3a2, men1, pc, fgf3 and cycd1 genes define two
RT   regions of conserved synteny between linkage group 7 and human chromosome
RT   11q13";
RL   Gene 261(2):235-242(2000).
XX
RN   [2]
RP   1-1271
RA   Yoder J.A., Litman G.W.;
RT   ;
RL   Submitted (14-AUG-2000) to the INSDC.
RL   Children's Research Institute, University of South Florida, 140 Seventh
RL   Avenue South, St. Petersburg, FL 33701, USA
XX
RN   [3]
RC   Sequence update by database staff to remove vector contamination
RP   1-1271
RA   Yoder J.A., Litman G.W.;
RT   ;
RL   Submitted (25-JUL-2018) to the INSDC.
RL   Children's Research Institute, University of South Florida, 140 Seventh
RL   Avenue South, St. Petersburg, FL 33701, USA
XX
DR   MD5; e795d9c2b0336c72cca93dd8bb462977.
XX
CC   On Jul 25, 2018 this sequence version replaced AF295377.1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1271
FT                   /organism="Danio rerio"
FT                   /chromosome="LG7"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7955"
FT   gene            1..1271
FT                   /gene="cd81"
FT   CDS_pept        42..752
FT                   /codon_start=1
FT                   /gene="cd81"
FT                   /product="Cd81"
FT                   /note="similar to mammalian target of antiproliferative
FT                   antibody 1 (TAPA1)"
FT                   /db_xref="GOA:Q9DDS7"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DDS7"
FT                   /db_xref="ZFIN:ZDB-GENE-000831-5"
FT                   /protein_id="AAG37840.1"
FT                   /translation="MGVGVEGCTKCIKYMLFFFNFIFWLAGCVILGVSLWLRHDTKTSS
FT                   LLDLKYEGTESPTTFYISVYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFACLVLLF
FT                   ACEVAAGIWGFMNKDKISKEVIGFYDSVYDKGATYNADNKNPATAVLKVFHETLQCCGK
FT                   GNLFTAIVDRWLTDTCPEHLRTNAVDCHTEIKNLFTDKISLIGIAALVVAVIMIFEMIF
FT                   SMVLCCGIRNSPVY"
XX
SQ   Sequence 1271 BP; 310 A; 278 C; 267 G; 414 T; 2 other;
     ttcatcaacc ggctttaaaa catccttcag aaaccgacac catgggcgtg ggcgtggaag        60
     gctgcacgaa atgcatcaaa tacatgctct tcttcttcaa tttcatcttc tggctggctg       120
     gttgtgtaat cttgggggtt tctctctggc tccgtcatga cactaaaacg agcagtcttc       180
     tggacctgaa gtatgaggga acagaatcac ccaccacttt ctacatcagt gtctacatct       240
     tgattgctgt cggcgctgtg atgatgtttg ttggatttct tggatgctat ggagccattc       300
     aggagtccca gtgtcttctt ggaaccttct ttgcctgcct ggtccttctt tttgcctgtg       360
     aggttgccgc tggaatctgg ggattcatga acaaagacaa gatctccaaa gaggtaatcg       420
     gtttctatga ctctgtgtat gacaaaggcg ctacctacaa cgctgacaac aagaatcctg       480
     ccactgctgt cctaaaggtc tttcatgaga ctcttcagtg ctgtggcaaa ggaaaccttt       540
     ttacagccat tgttgatagg tggctcactg acacctgtcc tgaacattta agaacaaatg       600
     ctgtggactg tcacaccgag atcaagaatc ttttcactga caagatcagc ctgatcggca       660
     tcgctgccct ggttgttgct gtgatcatga tcttcgagat gatcttcagc atggtgcttt       720
     gctgcggcat caggaacagc cctgtgtatt aaaacaaggg caagatatga cctttaaaac       780
     atcagccaaa aaaaatcgtt ttgttttata tctaccatct cctattttgt tttgtatcta       840
     ccattgtttc ctaatgtagt cgctctgtcc aattcctgaa gtcgcagatc aacttttgtg       900
     cattttattt gtcgaaaagt ggcggtggaa caccaacaac tagtctgctc tcgtttacgc       960
     tgtagttggt gatggctagc tttasagtag acttataaac acacagagta cattatcaca      1020
     tgaaggatgg atacatttat ttgcttgtag tttcttttcg tgtgttttaa ctgttaagta      1080
     ccgctattgc tttggggtta ctattattct tttttcgtat gtataaactg tatatatttg      1140
     caggcctgta cgctcttagc atgaactcat actgracact cttttccatc ttcctctctg      1200
     tttgtatgta ctcgtctctt cctgagaaac actaaataaa cagtgtagta gtaagtagct      1260
     agatacgtgc t                                                           1271
//

If you have problems or comments...

PBIL Back to PBIL home page