(data stored in ACNUC18858 zone)

EMBL: AF300969

ID   AF300969; SV 1; linear; mRNA; STD; VRT; 1791 BP.
XX
AC   AF300969;
XX
DT   01-SEP-2003 (Rel. 77, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Danio rerio core 2 beta-1,6-N-acetylglucosaminyltransferase 3 (c2gnt3)
DE   mRNA, complete cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1791
RA   Schwientek T., Clausen H.;
RT   "Core 2 b-1,6-N-acetylglucosaminyltransferase";
RL   Unpublished.
XX
RN   [2]
RP   1-1791
RA   Schwientek T., Clausen H.;
RT   ;
RL   Submitted (29-AUG-2000) to the INSDC.
RL   School of Dentistry, Copenhagen University, Norre alle 20, Copenhagen 2200,
RL   Denmark
XX
DR   MD5; 93dd99ea97499a70f6e629fe04fa8be1.
DR   Ensembl-Gn; ENSDARG00000035198; danio_rerio.
DR   Ensembl-Tr; ENSDART00000050988; danio_rerio.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1791
FT                   /organism="Danio rerio"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7955"
FT   gene            1..1791
FT                   /gene="c2gnt3"
FT   CDS_pept        125..1411
FT                   /codon_start=1
FT                   /gene="c2gnt3"
FT                   /product="core 2 beta-1,6-N-acetylglucosaminyltransferase
FT                   3"
FT                   /db_xref="GOA:Q71SG7"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q71SG7"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-3231"
FT                   /protein_id="AAQ14484.1"
FT                   /translation="MRRCAVLHRLRCKFYVFVVSLFVVVKLVYLKISMDNSIYIEPYGV
FT                   TRRSLKPQPLDGINCTAIYELEPVEIGKSLEMRRKKIVEVDDGRIASFTADCKSYIEQR
FT                   RYNEVLVTDEECNFPIAYSLVVHKNSAMVERILRAIYAPQNIYCIHYDQKSTKDFIAAM
FT                   KNLESCFPNVFIASKIESVQYAHITRLKADLNCLSDLLSSEVKWKYVINLCGQDFPLKS
FT                   NYELVTELRKLNGANMLETSRPSKVKKQRFQFRYQLKDVSYEYQKMPVKTSIAKDPPPH
FT                   NIEMFVGSAYFVLSRDFVTYVMNNQLAKDFLQWSVDTYSPDEHFWASMARVPGVPGELA
FT                   RSEPDVSDLKSRTRLVKWNYLEERLYPKCTGTHRRSVCIYGAAELRWLLEDGHWFANKF
FT                   DPKVDPVIIKCLEEKLEEKQLQQCLRRVS"
XX
SQ   Sequence 1791 BP; 535 A; 343 C; 396 G; 517 T; 0 other;
     cacgcgtccg gcgcggtgaa gcagcaactc cacgcagtct caacagcagt tgtttatatt        60
     ttttgcaatg ttgagaaaca tttgatggca gtgacacaaa acaaaagacc ggcagtgtgc       120
     aagaatgaga agatgtgctg tcttacaccg gttaagatgc aagttctatg tgtttgtcgt       180
     gtcactgttt gtcgtggtga agctggtgta cttaaagatt tcaatggaca acagtatcta       240
     catcgagccc tatggagtta cacgtagatc tctcaaacct cagccactag atggtattaa       300
     ctgcacagcc atttatgaac tggaaccagt ggaaattggc aagtcgctgg agatgaggcg       360
     caaaaaaatt gtggaagttg atgatgggag aattgcttca ttcactgcgg attgcaaaag       420
     ctacatcgaa caaaggcgct acaatgaagt cttggtcact gatgaggaat gtaactttcc       480
     aatcgcatac tctttggtgg tgcacaagaa cagcgcaatg gtggaaagga tacttcgagc       540
     catctatgca cctcagaata tttactgcat tcattatgac caaaaatcca caaaggattt       600
     tattgcagcg atgaagaact tggagagttg ttttccaaat gtcttcatcg cctctaaaat       660
     cgaatccgtc cagtatgcgc acattaccag acttaaagca gatctcaatt gcctttcaga       720
     cttactgagt tcagaggtca aatggaaata tgtcatcaat ctgtgtggtc aagactttcc       780
     actgaagtct aattatgagc tggtgactga gctccggaaa ctaaacggcg caaacatgct       840
     cgaaacaagc aggcccagca aagtaaaaaa gcaacgcttt cagtttagat accagttgaa       900
     agatgtatcg tatgaatacc agaagatgcc tgttaaaacc tccattgcta aagacccacc       960
     gccgcataac attgagatgt ttgttggaag tgcttacttt gtcttgtcac gggattttgt      1020
     gacatatgtt atgaacaatc aactggcgaa ggattttctt cagtggtcag tcgacacata      1080
     ttctcccgat gagcactttt gggcatcaat ggcaagagtt cccggagttc ctggggagtt      1140
     agcaagatct gaacctgatg tgtcagacct gaagagcagg acacgtttgg ttaaatggaa      1200
     ctatctcgaa gagcgcttgt atccaaagtg cactggtaca cacagacgta gtgtctgcat      1260
     ctatggtgca gcggagctcc ggtggcttct ggaggacggc cattggtttg caaacaagtt      1320
     tgatcccaaa gttgaccctg tcattattaa atgtcttgag gagaaacttg aggagaagca      1380
     acttcaacaa tgcttgagga gagtgtctta aaagaggctt tctttgattg aaatatgcat      1440
     ctttgctgct cttatctctg ttcaaaacac cagcaagttg aaaggtttag ctgtatctta      1500
     aagttattcc attcacgttc atattgccgt ctgctacata tgctaggtct ttatgctaat      1560
     gagtttggaa gtgcctaaca gcttcagctt taatacttca cacaaatgat gaatgtgtgg      1620
     gggaaatatt tatacatttt aattaagtat ttattttaat ttatttaacc aacaatgtct      1680
     tgcatgaaga atctattgtt tactgaatca gtggtgacag ttttacaact tgattgtatt      1740
     tttcttttgt cattggtttt caaaataaac aatgcagcta aaaaaaaaaa a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page