(data stored in ACNUC26070 zone)

EMBL: AF302494

ID   AF302494; SV 1; linear; mRNA; STD; HUM; 1646 BP.
XX
AC   AF302494;
XX
DT   26-SEP-2000 (Rel. 65, Created)
DT   28-FEB-2001 (Rel. 66, Last updated, Version 2)
XX
DE   Homo sapiens voltage-gated K+ channel subunit MIRP2 (KCNE3) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1646
RX   DOI; 10.1074/jbc.M010713200.
RX   PUBMED; 11104781.
RA   Melman Y.F., Domenech A., de La Luna S., McDonald T.V.;
RT   "Structural determinants of KvLQT1 control by the KCNE family of proteins";
RL   J Biol Chem 276(9):6439-6444(2001).
XX
RN   [2]
RP   1-1646
RA   Domenech A., Estivill X., de la Luna S.;
RT   "Cloning of human MIRP2";
RL   Unpublished.
XX
RN   [3]
RP   1-1646
RA   Domenech A., Estivill X., de la Luna S.;
RT   ;
RL   Submitted (03-SEP-2000) to the INSDC.
RL   Medical and Molecular Genetics Center, Institut Recerca Oncologica, Avia
RL   Castelldefels km 2.7, L'Hospitalet de Llobregat, Barcelona 08907, Spain
XX
DR   MD5; 4a0dd85b091d1723b516c0df46c3172a.
DR   Ensembl-Gn; ENSG00000175538; homo_sapiens.
DR   Ensembl-Tr; ENST00000310128; homo_sapiens.
DR   Ensembl-Tr; ENST00000525550; homo_sapiens.
DR   EuropePMC; PMC150950; 11956246.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1646
FT                   /organism="Homo sapiens"
FT                   /chromosome="11"
FT                   /map="11q13-q14"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        306..617
FT                   /codon_start=1
FT                   /gene="KCNE3"
FT                   /product="voltage-gated K+ channel subunit MIRP2"
FT                   /db_xref="GOA:Q9Y6H6"
FT                   /db_xref="H-InvDB:HIT000076686.13"
FT                   /db_xref="HGNC:HGNC:6243"
FT                   /db_xref="InterPro:IPR000369"
FT                   /db_xref="InterPro:IPR005426"
FT                   /db_xref="PDB:2NDJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y6H6"
FT                   /protein_id="AAG16255.1"
FT                   /translation="METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEE
FT                   RRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI"
XX
SQ   Sequence 1646 BP; 423 A; 409 C; 413 G; 391 T; 10 other;
     tancccactg atnccccccc ggngggatna caggtcccaa cgcttggcca ccctggttaa        60
     gaggcccccc ttccancgan caaacggcca cccccggagc cttnctgagg gcagctctgg       120
     gctttcccag ctccgaagtc aatactgaga tcccagatgt gtccagagac atcctgaagc       180
     caggctcggg ggtggaggag ttagtgtgtc cacaaaggga ctccttgaaa ctgactgaga       240
     gcccagtgga tttgccagca gtctgagctt ctaccgagtc ttcccccacc tcaatccctg       300
     ttgctatgga gactaccaat ggaacggaga cctggtatga gagcctgcat gccgtgctga       360
     aggctctaaa tgccactctt cacagcaatt tgctctgccg gccagggcca gggctggggc       420
     cagacaacca gactgaagag aggcgggcca gcctacctgg ccgtgatgac aactcctaca       480
     tgtacattct ctttgtcatg tttctatttg ctgtaactgt gggcagcctc atcctgggat       540
     acacccgctc ccgcaaagtg gacaagcgta gtgaccccta tcatgtgtat atcaagaacc       600
     gtgtgtctat gatctaacac gagagggctg ggacggtgga agaccaagac acctggggat       660
     tgcgtctggg gcctccagaa ctctgctgtg gactgcatca ggtctcagtg tccctatctg       720
     taagatcaac aagaaacacg gttaagggag gtcgtcactg gggtgggaga agaggggctg       780
     gtagaccgaa gccttgtgca taaggatttt ttcccaggaa aagatagact ttataaacag       840
     tgggagccca tgaacaaaca tataaaagta gcaacagata atgaccaata actggttcan       900
     ttnntggagt attaggggcc tggggattgg agaacggaga agaagttgta gcagagggaa       960
     atgagacagg aagatgctct ggggacacat tttttatgtg ttatcttcag ccatgagaag      1020
     cagtgatgac tatcccatat cacagatatg atttaccacc accaccctgc ccccgctccc      1080
     gtgaagaaag cagggcaagt gctgtgctgc ccatttgggc ctgcatagtg ccatgattgg      1140
     aacccaggaa ctctggtctc cttgcctagt gcttttcaaa actctgtgct acacaggagt      1200
     ggatccaggc ctgaaggtca tacaattctg gggactctct ttaagaaaaa gaattctaaa      1260
     atatcttact tttgcaaaca ttatgaaaat atactgccac attaatatgt tgctagggcc      1320
     cctgctagga ccttaagaag gagctcatgt gagtcaggac cctgaatgtt agggctcgtt      1380
     agctctatgg ttcatatgct tcttgaacca agtcacaggg cacttcccag ccacattgcc      1440
     aggcaacagg actaaactac ctccaaagca agcagtcttt tcagttttga ctgagtgatg      1500
     tgagaaactt cttttctttt cttttctttt ttttttttga ggcagtctcc ctatgtcacc      1560
     caggctgtgt tgcagtgagc caagatcaca ccactgcact ccagcctggg tgacagagca      1620
     aggctctgtc tcaaaagaaa acaaaa                                           1646
//

If you have problems or comments...

PBIL Back to PBIL home page