(data stored in ACNUC23390 zone)

EMBL: AF308821

ID   AF308821; SV 1; linear; mRNA; STD; INV; 1793 BP.
XX
AC   AF308821;
XX
DT   20-NOV-2000 (Rel. 65, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Branchiostoma floridae Mnx homeodomain protein mRNA, complete cds.
XX
KW   .
XX
OS   Branchiostoma floridae (Florida lancelet)
OC   Eukaryota; Metazoa; Chordata; Cephalochordata; Branchiostomidae;
OC   Branchiostoma.
XX
RN   [1]
RP   1-1793
RX   DOI; 10.1007/s004270000124.
RX   PUBMED; 11455421.
RA   Ferrier D.E.K., Brooke N.M., Panopoulou G., Holland P.W.H.;
RT   "The Mnx homeobox gene class defined by HB9, MNR2 and amphioxus AmphiMnx";
RL   Dev. Genes Evol. 211(2):103-107(2001).
XX
RN   [2]
RP   1-1793
RA   Ferrier D.E.K., Brooke N.M., Panopoulou G., Holland P.W.H.;
RT   ;
RL   Submitted (27-SEP-2000) to the INSDC.
RL   AMS, University of Reading, Whiteknights, Reading, Berks RG6 6AJ, UK
XX
DR   MD5; 2087a990b554b0c015655e7e56f92c50.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1793
FT                   /organism="Branchiostoma floridae"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7739"
FT   CDS_pept        70..960
FT                   /codon_start=1
FT                   /product="Mnx homeodomain protein"
FT                   /note="similar to vertebrate HB9 and MNR2"
FT                   /db_xref="GOA:Q9GSF1"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GSF1"
FT                   /protein_id="AAG33015.1"
FT                   /translation="MMTESIKSFRIDDLLASDRRKLQRSSGLGVWSPRQRSPTASEPSP
FT                   RGQPDTPPVSPLAEESPKMSPPSSFVPRPGLLHLHPSAGLPLHPHPAYGQHHFPLTANG
FT                   THHFGFSGFHPHHPDHLKTAMPFEWVRAAGMIMPRMDYGVHPSQASPLCKTRRPRTAFT
FT                   SQQLLELEKYFKENKYLSRPKRFEVATALMLTETQVKIWFQNRRMKWKRSKKAKDEVTQ
FT                   DKSTNGSSKVTESSKMDDPKDTYNMADLSDPDEDCSEHALEEIDVTDSIDGSSDNEETR
FT                   PVQISLQTKSDVTTR"
XX
SQ   Sequence 1793 BP; 517 A; 443 C; 409 G; 424 T; 0 other;
     aaaccagtca ggacctcgaa gagaagggaa gctttttttt ccggtgaaaa gagaaagaga        60
     ggtctcaaca tgatgacgga aagtatcaag tcgtttcgta tcgatgacct ccttgcgtcg       120
     gaccggcgca agctgcagcg ctcctcgggg ctgggtgtgt ggagcccccg ccagcgaagc       180
     cctaccgcct cggagccaag tccacggggc cagcccgaca cgccgcccgt ctcaccccta       240
     gcggaagaga gtcccaagat gtccccgccg tctagtttcg tcccgagacc gggactacta       300
     cacctgcacc cgtccgccgg acttcccctg cacccgcacc cggcgtacgg tcagcaccac       360
     ttcccgttga ctgctaacgg gacgcaccac ttcgggttct cgggcttcca tccacatcac       420
     cccgaccatc tcaagacggc catgcccttc gagtgggtcc gtgcagcggg aatgatcatg       480
     ccaagaatgg attacggagt gcacccgtcc caggccagcc ccctgtgtaa gacccggcgg       540
     ccccgcaccg ccttcaccag ccagcagctc ctggagctgg agaagtactt caaggagaac       600
     aagtacctgt cccgccccaa acggttcgag gtggccacag ctctcatgct cacagaaaca       660
     caggtcaaaa tctggttcca gaatcgcaga atgaagtgga agagaagcaa gaaggccaaa       720
     gatgaagtga cacaagacaa atctacaaac gggagctcca aggtcaccga atcctccaaa       780
     atggacgacc ccaaagacac ttacaacatg gcggacctta gtgacccgga tgaagactgc       840
     agtgagcatg cgctggagga gattgacgtc acggacagta ttgatggttc atcagacaac       900
     gaagagacca ggccagtgca gatatcctta cagacaaaat ctgacgtcac aacaagatga       960
     ttccattaat ttacatgtcg tatcttctct agaatccaat gtctcctgta gctattctaa      1020
     tctatagaat acaatgtata gcctttcaat agtataaatt tgtcgatgtt ctccgttgta      1080
     agagatgtgt acagactata gcctttcaat agtataaatt tgtcgatgtt ctccgttgta      1140
     agagatgtgt acagacttgt aatatatatt tctttgtggt ttccagagga aaatgataag      1200
     cgcacacaca atgaaataat caaagccacg taagcattcc aatcgattga ccttctccac      1260
     gactgttcat gatgtaaggc accactgtga aatgatttat aaagaagtat cggtagatac      1320
     aaagatagca tcagttcagt cttttttgct taagtctgat tctagcaacc attgaaagta      1380
     ttctccaatc agaggttagg ctccggctat cttttattgg aaaaaactca caaaatagga      1440
     agccggaaaa acgcttaaaa tatatcataa actagtcgaa gcctaactta tgcctttgga      1500
     ctacgtagga agtgggctag agtgaacatg gctggactcg atgttgaaat tttattgcac      1560
     atatgttata gatattctca ggtgcttctc tctgtctctt tgcgtttgtg atcgcatctg      1620
     ttcctaccga cagtatataa gaagggccca ttgtgtgcag tgcagataag agtatatacc      1680
     gatggtattt caagtgtatt tattgtttgc atatatgtgt gtgatagaca ctaacgtgat      1740
     acgatgccag gtgcaccaca ataaaatcaa tatctcataa aaaaaaaaaa aaa             1793
//

If you have problems or comments...

PBIL Back to PBIL home page