(data stored in ACNUC15260 zone)

EMBL: AF309125

ID   AF309125; SV 1; linear; genomic DNA; STD; MUS; 649 BP.
XX
AC   AF309125;
XX
DT   31-DEC-2000 (Rel. 66, Created)
DT   06-MAR-2001 (Rel. 67, Last updated, Version 2)
XX
DE   Mus musculus clone mOR11-40b olfactory receptor gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-649
RX   DOI; 10.1006/geno.2000.6431.
RX   PUBMED; 11170746.
RA   Lapidot M., Pilpel Y., Gilad Y., Falcovitz A., Sharon D., Haaf T.,
RA   Lancet D.;
RT   "Mouse-human orthology relationships in an olfactory receptor gene
RT   cluster";
RL   Genomics 71(3):296-306(2001).
XX
RN   [2]
RP   1-649
RA   Lapidot M., Pilpel Y., Gilad Y., Falcovitz A., Sharon D., Haaf T.,
RA   Lancet D.;
RT   ;
RL   Submitted (27-SEP-2000) to the INSDC.
RL   Molecular Genetics, Weizmann Institute of Science, Rehovot 76100, Israel
XX
DR   MD5; 4f2d190b88f9937d55bf848b8c793d8f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..649
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /strain="129S6/SvEvTac"
FT                   /mol_type="genomic DNA"
FT                   /clone="mOR11-40b"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>649
FT                   /product="olfactory receptor"
FT   CDS_pept        <1..>649
FT                   /codon_start=2
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:Q9EPY9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EPY9"
FT                   /protein_id="AAG42795.1"
FT                   /translation="VMDVGCISVTIPSMLVRLLVQKHTIPYGDCLTQLFFFHLLAGVDC
FT                   FLLTAMAYDRFLAICQPLTYSTRMNYTIQRILVAMSWACAFSNALTHTVAISTLHFCGP
FT                   NVINHFYCDLPQLFQLSCSSTQLNELLLFGVGFIMAGTPMALIFISYIHVAAAVLRIRS
FT                   AEGRKKAFSTCSSHLTVVAMFYGTGMFNYMRLGSTKFSDKDKAIGIFNTVINP"
XX
SQ   Sequence 649 BP; 144 A; 180 C; 136 G; 189 T; 0 other;
     agtgatggat gtggggtgca tcagtgtcac tattccctcc atgttggttc ggctcttggt        60
     ccaaaagcat acaattccat atggagactg cctcacacag ctcttcttct tccatctgct       120
     ggctggggtt gactgtttcc tgttgacagc catggcttat gaccgcttcc tggccatctg       180
     ccagcccctc acttacagca cccgaatgaa ctacactata cagaggatct tggtggctat       240
     gtcctgggct tgtgccttta gcaatgcact gacacacaca gtagccatat ccacacttca       300
     cttctgtggc ccaaatgtaa tcaatcactt ctactgtgac ctgcctcagc tcttccagct       360
     gtcctgctcc agtacccagc tcaatgagct gctgctcttt ggagtgggtt tcataatggc       420
     aggaacccct atggcactca tttttatctc ttatatccat gtggcagctg cagttctgcg       480
     aattcgctct gctgaaggca gaaagaaagc tttctccaca tgcagctctc acctcactgt       540
     ggttgccatg ttctatggca caggcatgtt taactacatg agactgggtt ccaccaaatt       600
     ttcagataag gacaaagcta ttgggatttt caacactgtc atcaaccct                   649
//

If you have problems or comments...

PBIL Back to PBIL home page