(data stored in ACNUC8465 zone)

EMBL: AF324667

ID   AF324667; SV 2; linear; mRNA; STD; PLN; 1484 BP.
XX
AC   AF324667;
XX
DT   15-DEC-2000 (Rel. 66, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Arabidopsis thaliana At1g51660 (At1g51660/F19C24_26) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1484
RA   Shinn P., Chen H., Cheuk R., Kim C.J., Banh J., Bowser L., Carninci P.,
RA   Chung M.K., Goldsmith A.D., Hayashizaki Y., Ishida J., Jones T., Kamiya A.,
RA   Karlin-Neumann G., Kawai J., Lam B., Lee J.M., Lin J., Liu S.X.,
RA   Miranda M., Narusaka M., Nguyen M., Palm C.J., Pham P.K., Quach H.L.,
RA   Sakano H., Sakurai T., Satou M., Seki M., Southwick A., Toriumi M.,
RA   Yamada K., Yu G., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   "Arabidopsis cDNA clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1484
RA   Shinn P., Chen H., Cheuk R., Kim C.J., Banh J., Bowser L., Carninci P.,
RA   Chung M.K., Goldsmith A.D., Hayashizaki Y., Ishida J., Jones T., Kamiya A.,
RA   Karlin-Neumann G., Kawai J., Lam B., Lee J.M., Lin J., Liu S.X.,
RA   Miranda M., Narusaka M., Nguyen M., Palm C.J., Pham P.K., Quach H.L.,
RA   Sakano H., Sakurai T., Satou M., Seki M., Southwick A., Toriumi M.,
RA   Yamada K., Yu G., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (29-NOV-2000) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
RN   [3]
RP   1-1484
RA   Shinn P., Chen H., Cheuk R., Kim C.J., Banh J., Bowser L., Carninci P.,
RA   Chung M.K., Goldsmith A.D., Hayashizaki Y., Ishida J., Jones T., Kamiya A.,
RA   Karlin-Neumann G., Kawai J., Lam B., Lee J.M., Lin J., Liu S.X.,
RA   Miranda M., Narusaka M., Nguyen M., Palm C.J., Pham P.K., Quach H.L.,
RA   Sakano H., Sakurai T., Satou M., Seki M., Southwick A., Toriumi M.,
RA   Yamada K., Yu G., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (09-MAR-2001) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; a1a97ba76ec13408d8fe10b100360848.
XX
CC   On Mar 9, 2001 this sequence version replaced gi:11692829.
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Shinn,P., Chen,H.,
CC   Cheuk,R., Kim,C.J., Koesema,E., Meyers,M.C., Tracy,S.E., Banh,J.
CC   Bowser,L., Chung,M.K., Goldsmith,A.D., Jones,T., Karlin-Neumann,G.,
CC   Lam,B., Lee,J.M., Lin,J., Liu,S.X., Miranda,M., Nguyen,M.,
CC   Palm,C.J., Pham,P.K., Quach,H.L., Sakano,H., Southwick,A.,
CC   Tang,C.C., Toriumi,M., Yamada,K., Yu,G., Davis,R.W., Theologis,A.,
CC   and Ecker,J.R.
CC   Shinn,P. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1484
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="1"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL2-4-A9(R12008)"
FT                   /note="ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..128
FT                   /gene="At1g51660/F19C24_26"
FT   CDS_pept        129..1229
FT                   /codon_start=1
FT                   /gene="At1g51660/F19C24_26"
FT                   /product="At1g51660"
FT                   /note="MAP kinase kinase 4 (ATMKK4)"
FT                   /db_xref="GOA:O80397"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:O80397"
FT                   /protein_id="AAG40018.1"
FT                   /translation="MRPIQSPPGVSVPVKSRPRRRPDLTLPLPQRDVSLAVPLPLPPTS
FT                   GGSGGSSGSAPSSGGSASSTNTNSSIEAKNYSDLVRGNRIGSGAGGTVYKVIHRPSSRL
FT                   YALKVIYGNHEETVRRQICREIEILRDVNHPNVVKCHEMFDQNGEIQVLLEFMDKGSLE
FT                   GAHVWKEQQLADLSRQILSGLAYLHSRHIVHRDIKPSNLLINSAKNVKIADFGVSRILA
FT                   QTMDPCNSSVGTIAYMSPERINTDLNQGKYDGYAGDIWSLGVSILEFYLGRFPFPVSRQ
FT                   GDWASLMCAICMSQPPEAPATASPEFRHFISCCLQREPGKRRSAMQLLQHPFILRASPS
FT                   QNRSPQNLHQLLPPPRPLSSSSSPTT"
FT   3'UTR           1230..1484
FT                   /gene="At1g51660/F19C24_26"
XX
SQ   Sequence 1484 BP; 376 A; 305 C; 338 G; 465 T; 0 other;
     aacgcacgac gacgaagaag tcgaagaaga ctactactat aaacgacgaa gatcattact        60
     tcaatcttca atcgagcttt taaattttca gatcgtagaa gaaaatcgaa cttttgattc       120
     caaaagcgat gagaccgatt caatcgcctc caggagtttc cgttccggtg aaaagccgtc       180
     cccgtcgccg tcctgatctt accttaccgc ttcctcaacg cgatgtttct ctcgctgtac       240
     ctcttcctct cccacctact tccggtggtt ccggtggctc tagtggatct gcgccgtctt       300
     ctggtggttc ggcgtcttca acgaacacta acagctccat agaagcgaag aactattcgg       360
     atttagtgag aggtaaccgt atcggaagcg gagcaggtgg aacggtatac aaagtgattc       420
     accgtccgag ttctcgtcta tatgcactta aggtgatata cggtaaccac gaggagactg       480
     tgagacgtca gatctgtaga gagatcgaga ttttacgaga tgtgaatcat ccaaacgttg       540
     tgaaatgtca cgagatgttt gatcagaacg gtgagatcca ggttttgctt gagtttatgg       600
     ataaaggttc tttagaaggt gctcatgtgt ggaaagagca acaattagct gatctatctc       660
     gtcagattct tagtggttta gcttatctcc atagccgtca catagttcat cgtgatatca       720
     aaccatcgaa tcttttgata aactctgcta aaaacgttaa gattgctgat tttggagtta       780
     gtaggatctt ggctcagact atggatccgt gtaattcatc tgttggaacc attgcttata       840
     tgagtcctga gaggattaac actgatttga atcagggaaa gtatgatggt tatgctggag       900
     atatttggag cttaggtgtt agcattttgg agttttactt ggggaggttt cctttccctg       960
     tgagtagaca aggtgattgg gctagtctta tgtgtgccat ttgtatgtct cagcctccag      1020
     aagctccagc gactgcgtcg ccggagtttc ggcattttat ctcgtgttgc ttgcagagag      1080
     aaccggggaa aaggaggagt gctatgcagc tattgcagca tcctttcata ttaagagcaa      1140
     gtccgagcca gaacaggtct cctcagaatc tacatcaact cttgcctcct cctcgtcctc      1200
     tgtcctcgtc ttcttctcca accacatagc gttttctctc ttcttccctt catcaactca      1260
     tattttttgt gttactactg ttcttgagtc tgttgtccaa ttttttgcta atcatggagg      1320
     gtctctgaat tttacattta ttagggagta aaaaactcga gagagggttt ttgggattat      1380
     tgttttctag aaaggtaaaa gagaacaatg ataatattct tatgcttatg atggtgcatg      1440
     tatccccaat gtagctttgt tgaattttca taaaagtttt tgcc                       1484
//

If you have problems or comments...

PBIL Back to PBIL home page