(data stored in ACNUC8465 zone)

EMBL: AF326878

ID   AF326878; SV 1; linear; mRNA; STD; PLN; 1499 BP.
XX
AC   AF326878;
XX
DT   21-DEC-2000 (Rel. 66, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Arabidopsis thaliana putative MAP kinase kinase 4 (At1g51660) mRNA,
DE   complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1499
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Full Length cDNA Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1499
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (07-DEC-2000) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; cfd99c56e370d284b3150cf62babb7c0.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Yamada,K., Liu,S.X.,
CC   Sakano,H., Pham,P.K., Banh,J., Chung,M.K., Goldsmith,A.D.,
CC   Lee,J.M., Quach,H.L., Toriumi,M., Yu,G., Bowser,L., Chen,H.,
CC   Cheuk,R., Jones,T., Karlin-Neumann,G., Kim,C., Lam,B., Lin,J.,
CC   Miranda,M., Nguyen,M., Palm,C.J., Shinn,P., Southwick,A.,
CC   Davis,R.W., Ecker,J.R. and Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP/PGEC)
CC   contributed equally to this work as PIs.
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to Genbank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1499
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="1"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL02-04-A09 (R09035)"
FT                   /note="This clone is in pBluescript vector as a XhoI/SstI
FT                   insert. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..128
FT                   /gene="At1g51660"
FT   CDS_pept        129..1229
FT                   /codon_start=1
FT                   /gene="At1g51660"
FT                   /product="putative MAP kinase kinase 4"
FT                   /db_xref="GOA:O80397"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:O80397"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAG41460.1"
FT                   /translation="MRPIQSPPGVSVPVKSRPRRRPDLTLPLPQRDVSLAVPLPLPPTS
FT                   GGSGGSSGSAPSSGGSASSTNTNSSIEAKNYSDLVRGNRIGSGAGGTVYKVIHRPSSRL
FT                   YALKVIYGNHEETVRRQICREIEILRDVNHPNVVKCHEMFDQNGEIQVLLEFMDKGSLE
FT                   GAHVWKEQQLADLSRQILSGLAYLHSRHIVHRDIKPSNLLINSAKNVKIADFGVSRILA
FT                   QTMDPCNSSVGTIAYMSPERINTDLNQGKYDGYAGDIWSLGVSILEFYLGRFPFPVSRQ
FT                   GDWASLMCAICMSQPPEAPATASPEFRHFISCCLQREPGKRRSAMQLLQHPFILRASPS
FT                   QNRSPQNLHQLLPPPRPLSSSSSPTT"
FT   3'UTR           1230..1484
FT                   /gene="At1g51660"
XX
SQ   Sequence 1499 BP; 391 A; 305 C; 338 G; 465 T; 0 other;
     aacgcacgac gacgaagaag tcgaagaaga ctactactat aaacgacgaa gatcattact        60
     tcaatcttca atcgagcttt taaattttca gatcgtagaa gaaaatcgaa cttttgattc       120
     caaaagcgat gagaccgatt caatcgcctc caggagtttc cgttccggtg aaaagccgtc       180
     cccgtcgccg tcctgatctt accttaccgc ttcctcaacg cgatgtttct ctcgctgtac       240
     ctcttcctct cccacctact tccggtggtt ccggtggctc tagtggatct gcgccgtctt       300
     ctggtggttc ggcgtcttca acgaacacta acagctccat agaagcgaag aactattcgg       360
     atttagtgag aggtaaccgt atcggaagcg gagcaggtgg aacggtatac aaagtgattc       420
     accgtccgag ttctcgtcta tatgcactta aggtgatata cggtaaccac gaggagactg       480
     tgagacgtca gatctgtaga gagatcgaga ttttacgaga tgtgaatcat ccaaacgttg       540
     tgaaatgtca cgagatgttt gatcagaacg gtgagatcca ggttttgctt gagtttatgg       600
     ataaaggttc tttagaaggt gctcatgtgt ggaaagagca acaattagct gatctatctc       660
     gtcagattct tagtggttta gcttatctcc atagccgtca catagttcat cgtgatatca       720
     aaccatcgaa tcttttgata aactctgcta aaaacgttaa gattgctgat tttggagtta       780
     gtaggatctt ggctcagact atggatccgt gtaattcatc tgttggaacc attgcttata       840
     tgagtcctga gaggattaac actgatttga atcagggaaa gtatgatggt tatgctggag       900
     atatttggag cttaggtgtt agcattttgg agttttactt ggggaggttt cctttccctg       960
     tgagtagaca aggtgattgg gctagtctta tgtgtgccat ttgtatgtct cagcctccag      1020
     aagctccagc gactgcgtcg ccggagtttc ggcattttat ctcgtgttgc ttgcagagag      1080
     aaccggggaa aaggaggagt gctatgcagc tattgcagca tcctttcata ttaagagcaa      1140
     gtccgagcca gaacaggtct cctcagaatc tacatcaact cttgcctcct cctcgtcctc      1200
     tgtcctcgtc ttcttctcca accacatagc gttttctctc ttcttccctt catcaactca      1260
     tattttttgt gttactactg ttcttgagtc tgttgtccaa ttttttgcta atcatggagg      1320
     gtctctgaat tttacattta ttagggagta aaaaactcga gagagggttt ttgggattat      1380
     tgttttctag aaaggtaaaa gagaacaatg ataatattct tatgcttatg atggtgcatg      1440
     tatccccaat gtagctttgt tgaattttca taaaagtttt tgccaaaaaa aaaaaaaaa       1499
//

If you have problems or comments...

PBIL Back to PBIL home page