(data stored in SCRATCH zone)

EMBL: AF332390

ID   AF332390; SV 1; linear; mRNA; STD; PLN; 1344 BP.
XX
AC   AF332390;
XX
DT   11-JAN-2001 (Rel. 66, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Arabidopsis thaliana clone C00002 (e) 1-aminocyclopropane-1-carboxylate
DE   synthase ACS7 (At4g26200) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1344
RA   Yamada K., Dale J.M., Hsuan V.W., Onodera C.S., Quach H.L., Toriumi M.,
RA   Wong C., Wu H.C., Yu G., Yuan S., Chen H., Cheuk R., Jones T., Kim C.J.,
RA   Nguyen M., Palm C.J., Shinn P., Southwick A., Tripp M.G., Wu T.,
RA   Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Open Reading Frame (ORF) Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1344
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Etgu P., Lee J.M.,
RA   Toriumi M., Yu G., Brooks S., Chao Q., Chen H., Karlin-Neumann G., Kim C.,
RA   Lam B., Miranda M., Nguyen M., Palm C.J., Shinn P., Southwick A.,
RA   Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (28-DEC-2000) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
RN   [3]
RP   1-1344
RA   Yamada K., Dale J.M., Hsuan V.W., Onodera C.S., Quach H.L., Toriumi M.,
RA   Wong C., Wu H.C., Yu G., Yuan S., Chen H., Cheuk R., Jones T., Kim C.J.,
RA   Nguyen M., Palm C.J., Shinn P., Southwick A., Tripp M.G., Wu T.,
RA   Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (07-MAY-2003) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; aae7e48b7c5f5f41fd8b555cf63b520c.
XX
CC   Annotation based on July 2002 version of the Arabidopsis genome
CC   submitted to Genbank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1344
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="C00002 (e)"
FT                   /note="This clone is now in pUNI 51 vector. Previously, it
FT                   was in pUNI-T3-D/V5-His-TOPO under the clone number C00002.
FT                   ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..1344
FT                   /codon_start=1
FT                   /gene="At4g26200"
FT                   /product="1-aminocyclopropane-1-carboxylate synthase ACS7"
FT                   /db_xref="GOA:Q9STR4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STR4"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAG48754.1"
FT                   /translation="MGLPLMMERSSNNNNVELSRVAVSDTHGEDSPYFAGWKAYDENPY
FT                   DESHNPSGVIQMGLAENQVSFDLLETYLEKKNPEGSMWGSKGAPGFRENALFQDYHGLK
FT                   TFRQAMASFMEQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGF
FT                   DRDLRWRTGVKIVPIHCDSSNHFQITPEALESAYQTARDANIRVRGVLITNPSNPLGAT
FT                   VQKKVLEDLLDFCVRKNIHLVSDEIYSGSVFHASEFTSVAEIVENIDDVSVKERVHIVY
FT                   SLSKDLGLPGFRVGTIYSYNDNVVRTARRMSSFTLVSSQTQHMLASMLSDEEFTEKYIR
FT                   INRERLRRRYDTIVEGLKKAGIECLKGNAGLFCWMNLGFLLEKKTKDGELQLWDVILKE
FT                   LNLNISPGSSCHCSEVGWFRVCFANMSENTLEIALKRIHEFMDRRRRF"
XX
SQ   Sequence 1344 BP; 364 A; 306 C; 343 G; 331 T; 0 other;
     atgggtcttc ctctaatgat ggagagatca tcaaacaaca acaacgtcga gctttctcga        60
     gtggcggttt cagacactca cggcgaagac tcaccgtact tcgccggctg gaaagcttac       120
     gacgaaaatc cttacgacga atctcataac ccttccggtg tcatccaaat gggtctcgct       180
     gagaatcagg tctcgtttga tcttcttgaa acttacttgg agaagaagaa tccagaaggt       240
     tcgatgtggg gatcaaaagg agctcctggg ttccgtgaaa acgcattgtt tcaagactac       300
     cacggtctca aaactttcag acaagccatg gctagtttca tggaacagat tcgaggaggc       360
     aaagctagat ttgatcctga ccggatcgtc ctcaccgccg gagccaccgc cgctaacgaa       420
     ctcttaactt tcattctcgc cgatcctaac gacgcccttc tagttcccac accgtattat       480
     ccaggattcg atagagattt gagatggaga accggagtga aaatagtacc catccactgc       540
     gacagctcga accatttcca gataaccccg gaggcgctag agtcggcgta ccaaacggct       600
     cgtgacgcga acattagagt ccgaggagtg ctcataacca acccatcgaa cccattaggg       660
     gcgacggtcc aaaagaaggt tctagaagat ctccttgact tctgcgtacg caagaatatt       720
     cacttggtct cagacgagat ctactccggc tccgtcttcc atgcctccga gttcacaagc       780
     gttgccgaga tcgtagaaaa catagatgac gtgtcagtaa aggaacgagt tcacatcgtc       840
     tacagtctct ccaaggatct tggtcttcct ggtttccgcg tgggaactat atactcgtac       900
     aacgataatg ttgttcggac agcgagaagg atgtcgagct tcacgcttgt ctcgtctcag       960
     acacaacata tgctggcttc tatgttgtcg gatgaggagt ttacggagaa gtacattagg      1020
     ataaaccggg aaagacttag aagacggtac gataccattg tggaagggct taagaaggca      1080
     gggattgagt gtttgaaagg gaacgcaggg ctattttgtt ggatgaattt gggtttcttg      1140
     ctcgaaaaga aaactaaaga cggcgagctc cagctttggg atgtgatctt aaaggagctg      1200
     aacctgaata tatctccggg atcttcgtgc cactgctcgg aggtcggatg gtttagggtt      1260
     tgttttgcta atatgagtga gaacactttg gagattgcgt tgaagagaat acatgagttc      1320
     atggaccgac gaaggaggtt ttga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page