(data stored in ACNUC15324 zone)

EMBL: AF333251

ID   AF333251; SV 1; linear; mRNA; STD; MUS; 678 BP.
XX
AC   AF333251;
XX
DT   14-MAY-2001 (Rel. 67, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus Th2-specific cytokine FISP mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-678
RX   PUBMED; 11342597.
RA   Schaefer G., Venkataraman C., Schindler U.;
RT   "Cutting edge: FISP (IL-4-induced secreted protein), a novel cytokine-like
RT   molecule secreted by Th2 cells";
RL   J. Immunol. 166(10):5859-5863(2001).
XX
RN   [2]
RP   1-678
RA   Schaefer G., Venkataraman C., Schindler U.;
RT   ;
RL   Submitted (03-JAN-2001) to the INSDC.
RL   Biology, Tularik Inc, Two Corporate Drive, South San Francisco, CA 94080,
RL   USA
XX
DR   MD5; baa5a5a352ae710b96aac8eae35d9e07.
DR   EuropePMC; PMC2254543; 18178870.
DR   EuropePMC; PMC2662000; 18708357.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..678
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        1..663
FT                   /codon_start=1
FT                   /product="Th2-specific cytokine FISP"
FT                   /db_xref="GOA:Q925S4"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR020423"
FT                   /db_xref="InterPro:IPR020443"
FT                   /db_xref="InterPro:IPR020444"
FT                   /db_xref="MGI:MGI:2135548"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q925S4"
FT                   /protein_id="AAK52470.1"
FT                   /translation="MLTEPAQLFVHKKNQPPSHSSLRLHFRTLAGALALSSTQMSWGLQ
FT                   ILPCLSLILLLWNQVPGLEGQEFRFGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIR
FT                   LLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMS
FT                   QLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL"
XX
SQ   Sequence 678 BP; 168 A; 178 C; 161 G; 171 T; 0 other;
     atgctgactg agcctgccca actttttgtg cacaagaaga accagccacc ttcacacagc        60
     agcctccggc ttcactttag gaccctagca ggagcactgg ccctttcttc aacacagatg       120
     agttggggac tacagattct cccctgcctg agcctaatcc ttcttctttg gaaccaagtg       180
     ccagggcttg agggtcaaga gttccgattt gggtcttgcc aagtgacagg ggtggttctc       240
     ccagaactgt gggaggcctt ctggactgtg aagaacactg tgcaaactca ggatgacatc       300
     acaagcatcc ggctgttgaa gccgcaggtt ctgcggaatg tctcgggtgc tgagagctgt       360
     taccttgccc acagcctgct gaagttctac ttgaacactg ttttcaagaa ctaccacagc       420
     aaaatagcca aattcaaggt cttgaggtca ttctccactc tggccaacaa cttcatagtc       480
     atcatgtcac aactacagcc cagtaaggac aattccatgc ttcccattag tgagagtgca       540
     caccagcggt ttttgctgtt ccgcagagca ttcaaacagt tggatacaga agtcgctttg       600
     gtgaaagcct ttggggaagt ggacattctc ctgacctgga tgcagaaatt ctaccatctc       660
     tgactgctga ttggataa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page