(data stored in ACNUC8465 zone)

EMBL: AF349517

ID   AF349517; SV 1; linear; mRNA; STD; PLN; 1149 BP.
XX
AC   AF349517;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Arabidopsis thaliana putative MAP kinase kinase 4 (ATMKK4) (At1g51660)
DE   mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1149
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Etgu P., Lee J.M.,
RA   Toriumi M., Yu G., Brooks S., Chao Q., Chen H., Karlin-Neumann G., Kim C.,
RA   Lam B., Miranda M., Nguyen M., Palm C.J., Shinn P., Southwick A.,
RA   Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Open Reading Frame (ORF) Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1149
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninici P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (14-FEB-2001) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; 182a42d19f441f457f8729e2215962dd.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium  members constructed and
CC   sequenced the pUNI (ORF) clones using the RAFL cDNAs: Yamada,K.,
CC   Liu,S.X., Sakano,H., Pham,P.K., Banh,J., Chung,M.K.,
CC   Goldsmith,A.D., Lee,J.M., Quach,H.L., Toriumi,M., Yu,G., Bowser,L.,
CC   Chen,H., Cheuk,R., Jones,T., Karlin-Neumann,G., Kim,C., Lam,B.,
CC   Lin,J., Miranda,M., Nguyen,M., Palm,C.J., Shinn,P., Southwick,A.,
CC   Davis,R.W., Ecker,J.R. and Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP/PGEC)
CC   contributed equally to this work as PIs.
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to Genbank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1149
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="1"
FT                   /mol_type="mRNA"
FT                   /clone="U09035"
FT                   /note="This clone is in pUNI-T3-D/V5-His-TOPO. ecotype:
FT                   Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..1101
FT                   /codon_start=1
FT                   /gene="At1g51660"
FT                   /product="putative MAP kinase kinase 4 (ATMKK4)"
FT                   /db_xref="GOA:O80397"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:O80397"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAK15564.1"
FT                   /translation="MRPIQSPPGVSVPVKSRPRRRPDLTLPLPQRDVSLAVPLPLPPTS
FT                   GGSGGSSGSAPSSGGSASSTNTNSSIEAKNYSDLVRGNRIGSGAGGTVYKVIHRPSSRL
FT                   YALKVIYGNHEETVRRQICREIEILRDVNHPNVVKCHEMFDQNGEIQVLLEFMDKGSLE
FT                   GAHVWKEQQLADLSRQILSGLAYLHSRHIVHRDIKPSNLLINSAKNVKIADFGVSRILA
FT                   QTMDPCNSSVGTIAYMSPERINTDLNQGKYDGYAGDIWSLGVSILEFYLGRFPFPVSRQ
FT                   GDWASLMCAICMSQPPEAPATASPEFRHFISCCLQREPGKRRSAMQLLQHPFILRASPS
FT                   QNRSPQNLHQLLPPPRPLSSSSSPTT"
FT   3'UTR           1102..>1149
FT                   /gene="At1g51660"
FT   misc_difference 1147
FT                   /gene="At1g51660"
FT                   /note="not present in genomic sequence"
XX
SQ   Sequence 1149 BP; 268 A; 255 C; 272 G; 354 T; 0 other;
     atgagaccga ttcaatcgcc tccaggagtt tccgttccgg tgaaaagccg tccccgtcgc        60
     cgtcctgatc ttaccttacc gcttcctcaa cgcgatgttt ctctcgctgt acctcttcct       120
     ctcccaccta cttccggtgg ttccggtggc tctagtggat ctgcgccgtc ttctggtggt       180
     tcggcgtctt caacgaacac taacagctcc atagaagcga agaactattc ggatttagtg       240
     agaggtaacc gtatcggaag cggagcaggt ggaacggtat acaaagtgat tcaccgtccg       300
     agttctcgtc tatatgcact taaggtgata tacggtaacc acgaggagac tgtgagacgt       360
     cagatctgta gagagatcga gattttacga gatgtgaatc atccaaacgt tgtgaaatgt       420
     cacgagatgt ttgatcagaa cggtgagatc caggttttgc ttgagtttat ggataaaggt       480
     tctttagaag gtgctcatgt gtggaaagag caacaattag ctgatctatc tcgtcagatt       540
     cttagtggtt tagcttatct ccatagccgt cacatagttc atcgtgatat caaaccatcg       600
     aatcttttga taaactctgc taaaaacgtt aagattgctg attttggagt tagtaggatc       660
     ttggctcaga ctatggatcc gtgtaattca tctgttggaa ccattgctta tatgagtcct       720
     gagaggatta acactgattt gaatcaggga aagtatgatg gttatgctgg agatatttgg       780
     agcttaggtg ttagcatttt ggagttttac ttggggaggt ttcctttccc tgtgagtaga       840
     caaggtgatt gggctagtct tatgtgtgcc atttgtatgt ctcagcctcc agaagctcca       900
     gcgactgcgt cgccggagtt tcggcatttt atctcgtgtt gcttgcagag agaaccgggg       960
     aaaaggagga gtgctatgca gctattgcag catcctttca tattaagagc aagtccgagc      1020
     cagaacaggt ctcctcagaa tctacatcaa ctcttgcctc ctcctcgtcc tctgtcctcg      1080
     tcttcttctc caaccacata gcgttttctc tcttcttccc ttcatcaact catatttttt      1140
     gtgttatct                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page