(data stored in ACNUC21429 zone)

EMBL: AF360159

ID   AF360159; SV 1; linear; mRNA; STD; PLN; 2052 BP.
XX
AC   AF360159;
XX
DT   22-MAR-2001 (Rel. 67, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Arabidopsis thaliana putative ubiquitin protein (At2g17190) mRNA, complete
DE   cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-2052
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Full Length cDNA Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-2052
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (13-MAR-2001) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; da97862f4cf1262153425bd2df7f8590.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Yamada,K., Liu,S.X.,
CC   Sakano,H., Pham,P.K., Banh,J., Chung,M.K., Goldsmith,A.D.,
CC   Lee,J.M., Quach,H.L., Toriumi,M., Yu,G., Bowser,L., Chen,H.,
CC   Cheuk,R., Jones,T., Karlin-Neumann,G., Kim,C., Lam,B., Lin,J.,
CC   Miranda,M., Nguyen,M., Palm,C.J., Shinn,P., Southwick,A.,
CC   Davis,R.W., Ecker,J.R. and Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP/PGEC)
CC   contributed equally to this work as PIs.
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to Genbank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2052
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="2"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL09-15-A06 (R09422)"
FT                   /note="This clone is in a modified pBluescript vector
FT                   (FLC-1) as a BamHI/XhoI insert. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..167
FT                   /gene="At2g17190"
FT   CDS_pept        168..1784
FT                   /codon_start=1
FT                   /gene="At2g17190"
FT                   /product="putative ubiquitin protein"
FT                   /note="contains a ubiquitin domain PF00240 and a UBA domain
FT                   PF00627"
FT                   /db_xref="GOA:Q9SII9"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SII9"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAK25869.1"
FT                   /translation="MGGEADSRQPLTAEGVAVAVNVRCSNGTKFSVTTSLDSTVESFKE
FT                   LIAQNSDVPANQQRLIYKGRILKDDQTLLSYGLQADHTVHMVRGFVPSSPSAPAANAGN
FT                   QTTAPQAVGSNDSSNLGGGESLFPGLGFNPLGGGNAMAGLFGSGLPDLEQAQQQLAQNP
FT                   NMIREMMNTPAIQNLMNNPEFMRSMIMNNPQMRELVDRNPELGHVLNDPSILRQTLEAA
FT                   RNPELMREMMRNTDRAMSNIESMPEGFNMLRRMYENVQEPLMNATTMSENAGNNTSSNP
FT                   FAALLGNQGVTTQGSDTSNNISAPNAETGTPNANPLPNPWGATAGQTTAPGRTNAGLGG
FT                   LGGLGGLGGLGMLGADSPLGATPDASQLSQILQNPAMSQMMQSVLSNPQYMNQLMSLNP
FT                   QLRSMLDMNPQLREMMQNPDFLRQFSSPEMMQQMMSLQQSLFSQNRNTAGQDPTQTGAA
FT                   TGTANNGGLDLLMNMFGSLGAGGLSGTNQPNVPPEERFATQLQQLQEMGFYDRAENIRA
FT                   LLATNGNVNAAVERLLGSIGQ"
FT   3'UTR           1785..2052
FT                   /gene="At2g17190"
XX
SQ   Sequence 2052 BP; 560 A; 457 C; 466 G; 569 T; 0 other;
     attcgaccaa aaataattta tatccctttc ctcaagaaat cttcagaacc gacttattag        60
     agcttcgagt ctcctcaaat cttcttctac gattttttct tctaggttta gagcttttga       120
     ttctccgatc aatttcgcga tttgttgaac taggatctga aattagaatg ggtggtgaag       180
     cagattcgag gcagccgctg actgctgaag gcgtagctgt tgccgtgaac gtcagatgct       240
     ccaatggcac gaaatttagt gtgacgacga gcctcgattc cacggtggag tctttcaaag       300
     agttaattgc gcagaacagc gatgtgccgg caaatcagca gcgtttgatt tacaagggac       360
     gtatcctcaa agacgatcag actctcctca gctatggttt gcaggctgat cacaccgttc       420
     atatggttcg aggttttgtg ccttcttctc cttctgctcc cgctgcaaat gctggaaacc       480
     aaaccactgc tcctcaagcg gttggttcaa atgatagctc aaacctcgga ggaggtgaat       540
     ctttgttccc tggccttgga tttaatcctt tgggtggtgg aaatgctatg gctggattat       600
     ttggatctgg tcttcctgat cttgagcagg cacagcaaca actagctcag aaccctaaca       660
     tgattagaga gatgatgaat actccagcca tccagaatct tatgaacaac ccagaattta       720
     tgaggagtat gattatgaat aaccctcaaa tgcgtgagct tgtagatcgc aatcctgagc       780
     ttggtcatgt gctcaatgac ccaagcatcc ttcgtcaaac tctagaagcg gcgagaaacc       840
     cagagcttat gcgtgaaatg atgagaaata ctgatagggc tatgagtaat attgagtcta       900
     tgcctgaggg atttaacatg cttaggcgta tgtatgaaaa tgtccaggaa ccgttaatga       960
     atgctaccac tatgtccgag aatgctggaa acaatacgag ctctaatcca tttgctgctc      1020
     ttctgggaaa ccagggggtt actacacaag gaagcgatac ttctaataat atttcggcac      1080
     cgaatgctga aacgggtaca cctaatgcaa atccacttcc taatccttgg ggtgccacgg      1140
     ctggccagac aactgcccct ggaaggacaa atgctggact tggtggtctt ggtgggcttg      1200
     gaggccttgg tggactcggt atgctgggag cggactcacc tcttggtgcg actccagatg      1260
     cttctcaatt gagccaaata ctgcaaaacc ccgctatgtc gcagatgatg caaagcgtac      1320
     tttccaatcc acagtacatg aatcagctta tgagtcttaa cccacaactc cgaagcatgc      1380
     tagatatgaa tcctcagttg agggaaatga tgcagaaccc tgatttcctt cgccagttta      1440
     gctctcccga gatgatgcag caaatgatgt ctctacaaca atcacttttc tctcagaata      1500
     ggaacacggc tggccaggat cctacgcaaa ctggtgctgc gacagggaca gccaataacg      1560
     gaggactaga tttattgatg aatatgtttg gcagccttgg tgctggcggc ctaagtggca      1620
     caaaccaacc caatgttcct cctgaagagc gatttgcgac tcagttgcaa cagttgcaag      1680
     aaatgggatt ctacgacaga gcagagaaca taagggcttt gcttgcaacc aatggtaacg      1740
     ttaacgctgc tgtagaacga ctcttgggga gtattggcca gtaacataca ggatcgcgaa      1800
     cttgtggata gaaaagccgc tcatcgatac actatttgtt ttcaatggtc atcttctttc      1860
     ctctttaccc aatccccaca acctttttta catactttgg gtcgtctgtt atctttcaga      1920
     ttctatttga agttgttacc tcgtacatct gtagaagttg atttcgaaat gtggaatggt      1980
     tacatttacg ttttcttatc tccattttac ttattaaata tagctgtagt gacgttgaaa      2040
     aaaaaaaaaa aa                                                          2052
//

If you have problems or comments...

PBIL Back to PBIL home page