(data stored in ACNUC13479 zone)

EMBL: AF360189

ID   AF360189; SV 1; linear; mRNA; STD; PLN; 1802 BP.
XX
AC   AF360189;
XX
DT   22-MAR-2001 (Rel. 67, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Arabidopsis thaliana unknown protein (At5g01820) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1802
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Full Length cDNA Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1802
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (13-MAR-2001) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; e1c75c282041f6f6620e70368eee3755.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Yamada,K., Liu,S.X.,
CC   Sakano,H., Pham,P.K., Banh,J., Chung,M.K., Goldsmith,A.D.,
CC   Lee,J.M., Quach,H.L., Toriumi,M., Yu,G., Bowser,L., Chen,H.,
CC   Cheuk,R., Jones,T., Karlin-Neumann,G., Kim,C., Lam,B., Lin,J.,
CC   Miranda,M., Nguyen,M., Palm,C.J., Shinn,P., Southwick,A.,
CC   Davis,R.W., Ecker,J.R. and Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP/PGEC)
CC   contributed equally to this work as PIs.
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to Genbank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1802
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL09-15-G15 (R09142)"
FT                   /note="This clone is in a modified pBluescript vector
FT                   (FLC-1) as a BamHI/XhoI insert. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..249
FT                   /gene="At5g01820"
FT   CDS_pept        250..1578
FT                   /codon_start=1
FT                   /gene="At5g01820"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q9LZW4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018451"
FT                   /db_xref="PDB:2ZFD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZW4"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAK25899.1"
FT                   /translation="MVDSDPVEFPPENRRGQLFGKYEVGKLVGCGAFAKVYHGRSTATG
FT                   QSVAIKVVSKQRLQKGGLNGNIQREIAIMHRLRHPSIVRLFEVLATKSKIFFVMEFAKG
FT                   GELFAKVSKGRFCEDLSRRYFQQLISAVGYCHSRGIFHRDLKPENLLLDEKLDLKISDF
FT                   GLSALTDQIRPDGLLHTLCGTPAYVAPEVLAKKGYDGAKIDIWSCGIILFVLNAGYLPF
FT                   NDHNLMVMYRKIYKGEFRIPKWTSPDLRRLLTRLLDTNPQTRITIEEIIHDPWFKQGYD
FT                   DRMSKFHLEDSDMKLPADETDSEMGARRMNAFDIISGSPGFNLSGLFGDARKYDRVERF
FT                   VSAWTAERVVERLEEIVSAENLTVAKKETWGMKIEGQKGNFAMVVEINQLTDELVMIEV
FT                   RKRQRAAASGRDLWTDTLRPFFVELVHESDQTDPEPTQVHTTS"
FT   3'UTR           1579..1802
FT                   /gene="At5g01820"
FT   misc_difference 1786
FT                   /gene="At5g01820"
FT                   /note="not present in genomic sequence"
XX
SQ   Sequence 1802 BP; 482 A; 422 C; 425 G; 473 T; 0 other;
     atctcttatc cgaatcctcc caatttgtct gtctctcttt tgttttctct gctaacagat        60
     ctctctaaat atctgttact tttgttcata tctttttact tttcaaacta ctaattttcc       120
     tttcgcttct tctattaata acaacactct ctctctcaga cttcttttct tttttttcta       180
     cggcgttgat tcattcgcaa tgacctcagt ttctgtgtac cataattgac ctagcagatt       240
     ctgtttttaa tggtagattc tgacccggtg gaatttccgc cggagaaccg ccgtggacag       300
     ctcttcggca aatacgaggt cggaaaattg gtgggatgcg gcgccttcgc gaaagtgtac       360
     cacgggagga gcacagcgac gggtcagagc gttgcgatca aagtggtgag caagcaacgg       420
     ctgcagaaag gaggactcaa tggcaacatt cagagagaga tcgctatcat gcaccgtctg       480
     cgccaccctt ctatcgtgcg cctgttcgag gtcctcgcca ccaaatccaa gatcttcttc       540
     gtcatggaat tcgccaaggg cggtgagcta ttcgccaaag tctccaaggg caggttctgc       600
     gaggatctta gccgtcgtta tttccagcag ctcatctccg ccgtcggata ttgccactcc       660
     cgcggcatct ttcaccgtga tctcaaaccg gagaatctcc tcctcgacga gaagctcgat       720
     ttgaagatct ctgatttcgg actcagcgct cttaccgatc agatccgacc cgacggcctc       780
     ctccacacac tctgtggtac gccggcgtac gtggcgcctg aggttttggc gaagaaaggg       840
     tacgacggtg ctaaaatcga catatggtca tgtggaatca tactgttcgt cctcaacgcc       900
     ggttatctcc ctttcaacga ccataatctc atggttatgt accggaaaat ctacaaggga       960
     gaatttcgca ttcccaagtg gacctcaccg gatctccggc gactgctgac tcggctttta      1020
     gacacgaatc cgcagacgag gatcactatc gaagagatca tccacgatcc atggttcaaa      1080
     cagggctacg acgatcggat gtctaaattc catctagagg actccgatat gaaactcccg      1140
     gcggacgaga ccgacagcga gatgggagca aggaggatga acgcattcga catcatctca      1200
     ggatctccag ggttcaatct ctccggtctt ttcggagacg ccagaaagta cgaccgagtg      1260
     gaacggttcg tgtcggcgtg gacggcggag agggtggtgg agaggctgga ggagatcgtg      1320
     tcggcggaga atctgacggt ggcgaagaag gaaacatggg ggatgaagat cgaggggcaa      1380
     aaaggtaact tcgcaatggt ggttgagata aaccagctaa cggacgagct ggttatgata      1440
     gaggtgagga agagacaaag agccgctgca tctggacgag atttatggac agatacactc      1500
     aggcctttct tcgtcgagct tgtgcacgaa tcagaccaaa cggacccaga accaactcaa      1560
     gtacatacga cgtcgtagtt taggtatctg tcaaataaat tatccaaata ataattaaaa      1620
     aaaaatatcc cgggttatat gtaattgctt ttttttttac ccggagaata tctctgacat      1680
     aattattcag gaaatttctc gacaaatctt aatttttagt tggcaagtat gtatcttctt      1740
     gttatgtaat cataattata ttttatataa atgaaaaata aaatacaaaa aaaaaaaaaa      1800
     aa                                                                     1802
//

If you have problems or comments...

PBIL Back to PBIL home page