(data stored in SCRATCH zone)

EMBL: AF360317

ID   AF360317; SV 1; linear; mRNA; STD; PLN; 956 BP.
XX
AC   AF360317;
XX
DT   22-MAR-2001 (Rel. 67, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Arabidopsis thaliana putative caffeoyl-CoA O-methyltransferase (At4g26220)
DE   mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-956
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Full Length cDNA Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-956
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (14-MAR-2001) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; 5339426bd22e99c9ea85b2560fb872dd.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Yamada,K., Liu,S.X.,
CC   Sakano,H., Pham,P.K., Banh,J., Chung,M.K., Goldsmith,A.D.,
CC   Lee,J.M., Quach,H.L., Toriumi,M., Yu,G., Bowser,L., Chen,H.,
CC   Cheuk,R., Jones,T., Karlin-Neumann,G., Kim,C., Lam,B., Lin,J.,
CC   Miranda,M., Nguyen,M., Palm,C.J., Shinn,P., Southwick,A.,
CC   Davis,R.W., Ecker,J.R. and Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP/PGEC)
CC   contributed equally to this work as PIs.
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to Genbank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..956
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL09-15-A15 (R09428)"
FT                   /note="This clone is in a modified pBluescript vector
FT                   (FLC-1) as a BamHI/XhoI insert. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..90
FT                   /gene="At4g26220"
FT   misc_difference 12
FT                   /gene="At4g26220"
FT                   /replace="t"
FT                   /note="compared to genomic sequence"
FT   CDS_pept        91..789
FT                   /codon_start=1
FT                   /gene="At4g26220"
FT                   /product="putative caffeoyl-CoA O-methyltransferase"
FT                   /db_xref="GOA:Q9C5D7"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5D7"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAK26027.1"
FT                   /translation="MAKDEAKGLLKSEELYKYILETSVYPREPEVLRELRNITHNHPQA
FT                   GMATAPDAGQLMGMLLNLVNARKTIEVGVFTGYSLLLTALTLPEDGKVIAIDMNRDSYE
FT                   IGLPVIKKAGVEHKIDFKESEALPALDELLNNKVNEGGFDFAFVDADKLNYWNYHERLI
FT                   RLIKVGGIIVYDNTLWGGSVAEPDSSTPEWRIEVKKATLELNKKLSADQRVQISQAALG
FT                   DGITICRRLY"
FT   3'UTR           790..956
FT                   /gene="At4g26220"
FT   misc_difference 939
FT                   /gene="At4g26220"
FT                   /replace="t"
FT                   /note="compared to genomic sequence"
XX
SQ   Sequence 956 BP; 276 A; 171 C; 244 G; 265 T; 0 other;
     atcacaccag actgtagtgg atgatcggaa actaagactt cagtcatctg agactttaca        60
     gtgtttgagg aacgaagatt gtgagacaca atggctaagg atgaagccaa gggattgctg       120
     aaaagtgaag agctctataa atatatactg gagactagtg tgtacccacg cgagccagag       180
     gttctcaggg agcttaggaa cattactcat aaccaccctc aagctggtat ggctactgca       240
     ccagacgctg gccagttgat ggggatgctg ctgaatctgg taaatgcaag aaagactatc       300
     gaggttgggg ttttcactgg atactctctt ctcctcactg ctcttacgct accagaagat       360
     ggcaaggtta tcgccattga catgaataga gactcgtatg aaataggatt gccggttata       420
     aagaaagctg gtgttgaaca caaaattgat ttcaaagagt ctgaagctct tccagccctc       480
     gacgagcttt taaacaataa agtgaatgag ggtggattcg acttcgcatt tgtggatgca       540
     gacaagctga attattggaa ctatcatgag aggcttatta gattgatcaa ggttggtggg       600
     atcatagtgt atgataacac tctctgggga ggatcagttg ctgaaccgga ctcgtccacg       660
     cccgagtgga ggatagaagt caagaaagca accctcgagc tgaacaagaa actctcggct       720
     gatcagcgtg tgcagatctc gcaagctgcg cttggcgatg gtatcactat ttgcaggagg       780
     ttatattgag cgagtattgt tgttctttgt gatctttagg gtcatatgat tgtgagccct       840
     ttatattgag ctattgtgat gcaagagtgt tattgttcta tgtgatattt tggttcctgt       900
     gtgaatgtga accttttcta tcaagtttgt ggatttctac aaaaaaaaaa aaaaaa           956
//

If you have problems or comments...

PBIL Back to PBIL home page