(data stored in SCRATCH zone)

EMBL: AF370342

ID   AF370342; SV 1; linear; mRNA; STD; PLN; 644 BP.
XX
AC   AF370342;
XX
DT   01-MAY-2001 (Rel. 67, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Arabidopsis thaliana unknown protein (AT4g26210) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-644
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Full Length cDNA Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-644
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Tang C.C., Toriumi M., Yu G.,
RA   Bowser L., Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J.,
RA   Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Koesema E.,
RA   Lam B., Lin J., Meyers M.C., Miranda M., Narusaka M., Nguyen M., Palm C.J.,
RA   Sakurai T., Satou M., Seki M., Shinn P., Southwick A., Shinozaki K.,
RA   Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (18-APR-2001) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; 338717530a0e2b382fabd7712833d83a.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Yamada,K., Liu,S.X.,
CC   Sakano,H., Pham,P.K., Banh,J., Chung,M.K., Goldsmith,A.D.,
CC   Lee,J.M., Quach,H.L., Tang,C.C., Toriumi,M., Yu,G., Bowser,L.,
CC   Chen,H., Cheuk,R., Jones,T., Karlin-Neumann,G., Kim,C., Koesema,E.,
CC   Lam,B., Lin,J., Meyers,M.C., Miranda,M., Nguyen,M., Palm,C.J.,
CC   Shinn,P., Southwick,A., Davis,R.W., Ecker,J.R. and Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP/PGEC)
CC   contributed equally to this work as PIs.
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to GenBank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..644
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL05-10-C19 (R09994)"
FT                   /note="This clone is in a modified pBluescript vector
FT                   (Lambda ZAP) as a XhoI/SstI insert. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..83
FT                   /gene="AT4g26210"
FT   CDS_pept        84..452
FT                   /codon_start=1
FT                   /gene="AT4g26210"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q9STR3"
FT                   /db_xref="InterPro:IPR006808"
FT                   /db_xref="UniProtKB/TrEMBL:Q9STR3"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAK44157.1"
FT                   /translation="MASKLLQLKSKACEASKFVSKHGTTYYKQLLDKNKMYIQEPATIE
FT                   KCNELSKQLLYTRLASIPGRSESFWKEVNHVKGLWKNRADLKVEDAGIAALFGLECFAW
FT                   YCAGEIVGRGFTFTGYYP"
FT   3'UTR           453..644
FT                   /gene="AT4g26210"
FT   misc_difference 627
FT                   /gene="AT4g26210"
FT                   /replace="t"
FT                   /note="compared to genomic sequence"
XX
SQ   Sequence 644 BP; 198 A; 125 C; 142 G; 179 T; 0 other;
     gttgttgatc cgattcccgc tctccttctc cggtagtaca atctccgtcg ccggttacat        60
     cagccaggga agagttttaa gagatggcat caaagttgct acaattgaaa tccaaggcat       120
     gtgaagcatc aaagtttgtt tccaagcatg gaacaactta ctacaaacag ttgctggata       180
     agaacaagat gtatatccag gagccagcta ctatagagaa atgcaatgaa ttgtctaagc       240
     agcttctcta cactcgtctt gctagcattc ctgggcgttc tgagtcattt tggaaggaag       300
     tcaatcacgt gaagggttta tggaagaatc gggcggattt gaaggttgaa gatgctggaa       360
     tagctgcact ttttggtctg gaatgctttg cgtggtactg tgcaggagag attgtaggaa       420
     ggggcttcac tttcaccggc tactaccctt gaagaaagaa agcaaccccc tcataaacaa       480
     acatgcgttt cagatccatt gaataccgaa aagccttttt atatcataat tagcggctta       540
     ttatctatct cactgctgac attagaagca aagttaattt ctgtttctct ggataattta       600
     tacacaaaag ttttgaaggt gaggcaccaa aaaaaaaaaa aaaa                        644
//

If you have problems or comments...

PBIL Back to PBIL home page