(data stored in ACNUC13479 zone)

EMBL: AF372877

ID   AF372877; SV 1; linear; mRNA; STD; PLN; 925 BP.
XX
AC   AF372877;
XX
DT   02-MAY-2001 (Rel. 67, Created)
DT   31-MAY-2001 (Rel. 67, Last updated, Version 2)
XX
DE   Arabidopsis thaliana AT5g01750/T20L15_20 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-925
RA   Cheuk R., Chen H., Kim C.J., Meyers M.C., Shinn P., Banh J., Bowser L.,
RA   Carninci P., Chung M.K., Goldsmith A.D., Hayashizaki Y., Ishida J.,
RA   Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B., Lee J.M., Lin J.,
RA   Liu S.X., Miranda M., Narusaka M., Nguyen M., Palm C.J., Pham P.K.,
RA   Quach H.L., Sakano H., Sakurai T., Satou M., Seki M., Southwick A.,
RA   Toriumi M., Yamada K., Yu G., Shinozaki K., Davis R.W., Theologis A.,
RA   Ecker J.R.;
RT   "Arabidopsis cDNA clones";
RL   Unpublished.
XX
RN   [2]
RP   1-925
RA   Cheuk R., Chen H., Kim C.J., Meyers M.C., Shinn P., Banh J., Bowser L.,
RA   Carninci P., Chung M.K., Goldsmith A.D., Hayashizaki Y., Ishida J.,
RA   Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B., Lee J.M., Lin J.,
RA   Liu S.X., Miranda M., Narusaka M., Nguyen M., Palm C.J., Pham P.K.,
RA   Quach H.L., Sakano H., Sakurai T., Satou M., Seki M., Southwick A.,
RA   Toriumi M., Yamada K., Yu G., Shinozaki K., Davis R.W., Theologis A.,
RA   Ecker J.R.;
RT   ;
RL   Submitted (18-APR-2001) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 4ea50e9a72e99a5580694309694ceebe.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Shinn,P., Chen,H.,
CC   Cheuk,R., Kim,C.J., Koesema,E., Meyers,M.C., Tracy,S.E., Banh,J.
CC   Bowser,L., Chung,M.K., Goldsmith,A.D., Jones,T., Karlin-Neumann,G.,
CC   Lam,B., Lee,J.M., Lin,J., Liu,S.X., Miranda,M., Nguyen,M.,
CC   Palm,C.J., Pham,P.K., Quach,H.L., Sakano,H., Southwick,A.,
CC   Tang,C.C., Toriumi,M., Yamada,K., Yu,G., Davis,R.W., Theologis,A.,
CC   and Ecker,J.R.
CC   Shinn,P. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..925
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL02-10-I24(R12372)"
FT                   /note="ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..108
FT   CDS_pept        109..762
FT                   /codon_start=1
FT                   /product="AT5g01750/T20L15_20"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9LZX1"
FT                   /db_xref="InterPro:IPR007612"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="InterPro:IPR038595"
FT                   /db_xref="PDB:1ZXU"
FT                   /db_xref="PDB:2Q4M"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZX1"
FT                   /protein_id="AAK49593.1"
FT                   /translation="MEQPYVYAYPQGSGPSGAPTPQAGGVVVDPKYCAPYPIDMAIVRK
FT                   MMSLTDGNFVITDVNGNLLFKVKEPVFGLHDKRVLLDGSGTPVVTLREKMVSMHDRWQV
FT                   FRGGSTDQRDLLYTVKRSSMLQLKTKLDVFLGHNKDEKRCDFRVKGSWLERSCVVYAGE
FT                   SDAIVAQMHRKHTVQSVFLGKDNFSVTVYPNVDYAFIASLVVILDDVNREDRAA"
FT   3'UTR           763..925
XX
SQ   Sequence 925 BP; 268 A; 191 C; 233 G; 233 T; 0 other;
     gacggcataa taagaccaag aagaaaaaga aaacattaat ttcaaccaaa gcaaaacaga        60
     gagaaaaaaa tagagagagt gaatcaattt cggtggagaa agagaagaat ggagcagccg       120
     tacgtgtacg catacccgca aggtagtggc ccctcgggag ctccgactcc acaagccgga       180
     ggagtggtag tggatccaaa gtactgcgct ccttacccta tagatatggc gatcgtacgg       240
     aagatgatgt cgttaacgga cggcaatttc gtgataacgg acgtcaacgg aaacctgctg       300
     ttcaaggtga aggaaccggt gtttggtctc cacgacaaga gggtcttgct ggatggttct       360
     ggtactccgg tcgtcacttt gagagaaaag atggtgagca tgcatgacag gtggcaagtg       420
     tttagaggag ggagtacgga tcagcgtgat ctgctgtaca cggtgaaaag atcgtcgatg       480
     cttcagctaa agaccaaact cgatgtgttt ttgggacaca acaaagatga gaagagatgt       540
     gatttcagag tcaaagggag ttggctcgag cgttcttgtg ttgtttacgc cggcgaatct       600
     gacgccattg ttgcccaaat gcacaggaag cacacggtgc agagcgtatt cttgggaaaa       660
     gacaacttct cggtgactgt ttatccaaac gtcgattatg ccttcatcgc ctctctcgtc       720
     gtcattctcg atgacgtcaa ccgcgaagac cgcgccgcct gagagaagaa gatatcacct       780
     tctcttcttc ttaattatcc atccatcaat aatgtgctat tcatcaaccg ttaaaacttt       840
     gtgtgatcat ctcagttgta aaataatcaa atcattgtgc ctgtccttgt tgtttaatga       900
     ctacatttat aactgttttt tcatt                                             925
//

If you have problems or comments...

PBIL Back to PBIL home page