(data stored in ACNUC7820 zone)

EMBL: AF399539

ID   AF399539; SV 1; linear; genomic DNA; STD; HUM; 650 BP.
XX
AC   AF399539;
XX
DT   27-AUG-2001 (Rel. 68, Created)
DT   16-SEP-2004 (Rel. 81, Last updated, Version 2)
XX
DE   Homo sapiens clone OR7G2 olfactory receptor gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-650
RX   DOI; 10.1006/geno.2002.6830.
RX   PUBMED; 12213199.
RA   Fuchs T., Malecova B., Linhart C., Sharan R., Khen M., Herwig R.,
RA   Shmulevich D., Elkon R., Steinfath M., O'Brien J.K., Radelof U.,
RA   Lehrach H., Lancet D., Shamir R.;
RT   "DEFOG: a practical scheme for deciphering families of genes";
RL   Genomics 80(3):295-302(2002).
XX
RN   [2]
RP   1-650
RA   Fuchs T., Malecova B., Linhart C., Sharan R., Khen M., Herwig R.,
RA   Shmulevich D., Elkon R., Steinfath M., O'Brien J.K., Radelof U.,
RA   Lehrach H., Olender Z., Gluesman G., Lancet D., Shamir R.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Dept. of Molecular Genetics and the Crown Human Genome Center, Weizmann
RL   Institute of Science, Rehovot 76100, Israel
XX
DR   MD5; 2504aa02a3b91533d5b25a874d63ad4d.
DR   Ensembl-Gn; ENSG00000170923; homo_sapiens.
DR   Ensembl-Tr; ENST00000641081; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..650
FT                   /organism="Homo sapiens"
FT                   /chromosome="19"
FT                   /map="11.242943"
FT                   /mol_type="genomic DNA"
FT                   /clone="OR7G2"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>650
FT                   /product="olfactory receptor"
FT   CDS_pept        <1..>650
FT                   /codon_start=1
FT                   /product="olfactory receptor"
FT                   /note="contains transmembrane regions 2-7"
FT                   /db_xref="GOA:Q8NG99"
FT                   /db_xref="H-InvDB:HIT000383956.7"
FT                   /db_xref="HGNC:HGNC:8466"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NG99"
FT                   /protein_id="AAK95024.1"
FT                   /translation="FLDICLSTTTIPKMLVNIQAQNRSITYSGCLTQICFVLFFAGLEN
FT                   CLLAAMAYDRYVAICHPLRYTVIMNPRLCGLLILLSLLTSVVNALLLSLMVLRLSFCTD
FT                   LEIPLFFCELAQVIQLTCSDTLINNILIYFAACIFGGVPLSGIILSYTQITSCVLRMPS
FT                   ASGKHKAVSTCGSHLSIVLLFYGAGLGVYISSVVTDSPRKAAVASVMYSVFPQ"
XX
SQ   Sequence 650 BP; 130 A; 170 C; 139 G; 211 T; 0 other;
     tttttggaca tttgtttaag cacaaccacg atcccaaaga tgctggtgaa catccaagct        60
     cagaatcgga gcatcacgta ctcaggctgc ctcacccaga tctgctttgt cttgtttttt       120
     gctggcttgg aaaattgtct ccttgcagca atggcctatg accgctatgt ggccatttgt       180
     caccccctta gatacacagt catcatgaac ccccgcctct gtggcctgct gattcttctc       240
     tctctgttga ctagtgttgt gaatgccctt cttctcagcc tgatggtgtt gaggctgtcc       300
     ttctgcacag acctggaaat cccgctcttc ttctgtgaac tggctcaggt catccaactc       360
     acctgttcag acaccctcat caataacatc ctgatatatt ttgcagcttg catatttggt       420
     ggtgttcctc tgtctggaat cattttgtct tacactcaga tcacctcctg tgttttgaga       480
     atgccatcag caagtggaaa gcacaaagca gtttccacct gtgggtctca cctctccatt       540
     gttctcttgt tctatggggc aggtttgggg gtgtacatta gttctgtggt tactgactca       600
     cctaggaagg ctgcagtggc ttcagtgatg tattctgtgt tccctcaaat                  650
//

If you have problems or comments...

PBIL Back to PBIL home page