(data stored in ACNUC15260 zone)

EMBL: AF399564

ID   AF399564; SV 1; linear; genomic DNA; STD; HUM; 647 BP.
XX
AC   AF399564;
XX
DT   27-AUG-2001 (Rel. 68, Created)
DT   16-SEP-2004 (Rel. 81, Last updated, Version 2)
XX
DE   Homo sapiens clone OR1L8 olfactory receptor gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-647
RX   DOI; 10.1006/geno.2002.6830.
RX   PUBMED; 12213199.
RA   Fuchs T., Malecova B., Linhart C., Sharan R., Khen M., Herwig R.,
RA   Shmulevich D., Elkon R., Steinfath M., O'Brien J.K., Radelof U.,
RA   Lehrach H., Lancet D., Shamir R.;
RT   "DEFOG: a practical scheme for deciphering families of genes";
RL   Genomics 80(3):295-302(2002).
XX
RN   [2]
RP   1-647
RA   Fuchs T., Malecova B., Linhart C., Sharan R., Khen M., Herwig R.,
RA   Shmulevich D., Elkon R., Steinfath M., O'Brien J.K., Radelof U.,
RA   Lehrach H., Olender Z., Gluesman G., Lancet D., Shamir R.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Dept. of Molecular Genetics and the Crown Human Genome Center, Weizmann
RL   Institute of Science, Rehovot 76100, Israel
XX
DR   MD5; e0bb1fd37c78c14e70b08e12c207fcda.
DR   Ensembl-Gn; ENSG00000171496; homo_sapiens.
DR   Ensembl-Tr; ENST00000304865; homo_sapiens.
DR   Ensembl-Tr; ENST00000641027; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..647
FT                   /organism="Homo sapiens"
FT                   /chromosome="9"
FT                   /map="106.036111"
FT                   /mol_type="genomic DNA"
FT                   /clone="OR1L8"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>647
FT                   /product="olfactory receptor"
FT   CDS_pept        <1..>647
FT                   /codon_start=1
FT                   /product="olfactory receptor"
FT                   /note="contains transmembrane regions 2-7"
FT                   /db_xref="GOA:Q8NGR8"
FT                   /db_xref="H-InvDB:HIT000383979.7"
FT                   /db_xref="HGNC:HGNC:15110"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NGR8"
FT                   /protein_id="AAK95049.1"
FT                   /translation="LTDICFTTSVVPKMLMNFLSEKKTISYAGCLTQMYFLYALGNSDS
FT                   CLLAVMAFDRYVAVCDPFHYVTTMSHHHCVLLVAFSCSFPHLHSLLHTLLLNRLTFCDS
FT                   NVIHHFLCDLSPVLKLSCSSIFVNEIVQMTEAPIVLVTRFLCIAFSYIRILTTVLKIPS
FT                   TSGKRKAFSTCGFYLTVVTLFYGSIFCVYLQPPSTYAVKDHVATIVYTVLSS"
XX
SQ   Sequence 647 BP; 132 A; 193 C; 115 G; 207 T; 0 other;
     ctcactgata tttgctttac aacaagcgtt gtccccaaga tgctgatgaa cttcctgtca        60
     gaaaagaaga ccatctccta tgctgggtgt ctgacacaga tgtattttct ctatgccttg       120
     ggcaacagtg acagctgcct tctggcagtc atggcctttg accgctatgt ggccgtctgt       180
     gaccctttcc actatgtcac caccatgagc caccaccact gtgtcctgct ggtggccttc       240
     tcctgctcat ttcctcacct ccactcactc ctgcacacac ttctgctgaa tcgtctcacc       300
     ttctgtgact ccaatgttat ccaccacttt ctctgtgacc tcagccctgt gctgaaattg       360
     tcctgctctt ccatatttgt caatgaaatt gtgcagatga cagaagcacc tattgttttg       420
     gtgactcgtt ttctctgcat tgctttctct tatatacgaa tcctcactac agttctcaag       480
     attccctcta cttctgggaa acgcaaagcc ttctccacct gtggttttta cctcaccgtg       540
     gtgacgctct tttatggaag catcttctgt gtctatttac agcccccatc cacctacgct       600
     gtcaaggacc acgtggcaac aattgtttac acagttttgt catccat                     647
//

If you have problems or comments...

PBIL Back to PBIL home page