(data stored in ACNUC15260 zone)

EMBL: AF399589

ID   AF399589; SV 1; linear; genomic DNA; STD; HUM; 650 BP.
XX
AC   AF399589;
XX
DT   27-AUG-2001 (Rel. 68, Created)
DT   16-SEP-2004 (Rel. 81, Last updated, Version 2)
XX
DE   Homo sapiens clone OR5AX1 olfactory receptor gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-650
RX   DOI; 10.1006/geno.2002.6830.
RX   PUBMED; 12213199.
RA   Fuchs T., Malecova B., Linhart C., Sharan R., Khen M., Herwig R.,
RA   Shmulevich D., Elkon R., Steinfath M., O'Brien J.K., Radelof U.,
RA   Lehrach H., Lancet D., Shamir R.;
RT   "DEFOG: a practical scheme for deciphering families of genes";
RL   Genomics 80(3):295-302(2002).
XX
RN   [2]
RP   1-650
RA   Fuchs T., Malecova B., Linhart C., Sharan R., Khen M., Herwig R.,
RA   Shmulevich D., Elkon R., Steinfath M., O'Brien J.K., Radelof U.,
RA   Lehrach H., Olender Z., Gluesman G., Lancet D., Shamir R.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Dept. of Molecular Genetics and the Crown Human Genome Center, Weizmann
RL   Institute of Science, Rehovot 76100, Israel
XX
DR   MD5; 09bded0f74b068b98a6a187bf223f583.
DR   Ensembl-Gn; ENSG00000241128; homo_sapiens.
DR   Ensembl-Tr; ENST00000366485; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..650
FT                   /organism="Homo sapiens"
FT                   /chromosome="1"
FT                   /map="254.201279"
FT                   /mol_type="genomic DNA"
FT                   /clone="OR5AX1"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>650
FT                   /product="olfactory receptor"
FT   CDS_pept        <1..>650
FT                   /codon_start=1
FT                   /product="olfactory receptor"
FT                   /note="contains transmembrane regions 2-7"
FT                   /db_xref="GOA:Q96R54"
FT                   /db_xref="H-InvDB:HIT000384000.8"
FT                   /db_xref="HGNC:HGNC:15024"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96R54"
FT                   /protein_id="AAK95074.1"
FT                   /translation="FLDVFLVSVPIPKFIVNNLTHNNSISILGCAFQLLLMTSFSAGEI
FT                   FILTAMSYDRYVAICCPLNYEVIMNTGVCVLMASVSWAIGGLFGTAYTAGTFSMPFCGS
FT                   SVIPQFFCDVPSLLRISCSETLMVIYAGIGVGACLSISCFICIVISYIYIFSTVLKIPT
FT                   TKGQSKAFSTCFPHLTVFTVFIITAYFVYLKPPSNSPSVIDRLLSVIYTVMPPV"
XX
SQ   Sequence 650 BP; 140 A; 158 C; 113 G; 239 T; 0 other;
     tttttggatg tcttcctggt gtctgttcca atcccaaaat tcattgtcaa caacctaacc        60
     cacaacaatt ccatttccat tctaggatgt gccttccagc tacttttaat gacttccttc       120
     tcagcaggag agatatttat cctcactgcc atgtcctatg accgctatgt agccatctgc       180
     tgtcccctga actacgaggt aatcatgaat actggagtct gtgtgttaat ggcaagtgtt       240
     tcctgggcca ttggagggct ctttggtact gcgtacacag ctggcacatt ttccatgcct       300
     ttctgtggct ccagtgtgat tccacagttt ttctgtgatg ttccttcatt actaaggatt       360
     tcctgttctg aaacactaat ggtaatttat gcaggtattg gagttggtgc atgtttaagc       420
     atttcttgtt tcatctgtat tgtgatctct tacatttata tcttctccac tgtactgaag       480
     atccctacca ctaaaggtca gtccaaagct ttttccacat gcttccccca tctcactgtt       540
     ttcactgttt ttatcataac tgcttatttt gtttatctta agccaccttc aaattcacca       600
     tctgttattg acaggctgct ttctgtgatc tacactgtga tgcctccagt                  650
//

If you have problems or comments...

PBIL Back to PBIL home page