(data stored in ACNUC7421 zone)

EMBL: AF409088

ID   AF409088; SV 1; linear; genomic DNA; STD; PRO; 719 BP.
XX
AC   AF409088;
XX
DT   09-OCT-2001 (Rel. 69, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Salmonella typhimurium copper-responsive regulator (scr) gene, complete
DE   cds.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Typhimurium
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-719
RX   DOI; 10.1111/j.1574-6968.2002.tb11166.x.
RX   PUBMED; 12023084.
RA   Kim J.S., Kim M.H., Joe M.H., Song S.S., Lee I.S., Choi S.Y.;
RT   "The sctR of Salmonella enterica serova Typhimurium encoding a homologue of
RT   MerR protein is involved in the copper-responsive regulation of cuiD";
RL   FEMS Microbiol. Lett. 210(1):99-103(2002).
XX
RN   [2]
RP   1-719
RA   Choi S.-Y.;
RT   ;
RL   Submitted (09-AUG-2001) to the INSDC.
RL   Microbiology, HanNam University, 133 Ojung-Dong, Taeduk-Ku, Taejon 306-791,
RL   Korea
XX
DR   MD5; 820e1ec89c3a64fe1bebda23ce2889d7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..719
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhimurium"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:90371"
FT   CDS_pept        193..609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scr"
FT                   /product="copper-responsive regulator"
FT                   /note="SCR; similar to MerR"
FT                   /db_xref="GOA:Q93CH6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93CH6"
FT                   /protein_id="AAL11724.1"
FT                   /translation="MNISDVAKKTGLTSKAIRFYEEKGLVTPPLRSENGYRTYTQKHLN
FT                   ELTLLRQARQVGFNLEECGELVNLFNDPRRHSADVKKRTLEKVAEIERHISELQSMRDQ
FT                   LLALAESCPGDDSADCPIIDNLSGCCHHKAQKPR"
XX
SQ   Sequence 719 BP; 193 A; 168 C; 197 G; 161 T; 0 other;
     cgttgttcaa gactttcttt cacgcgttta acgcaatgac cgcaggacaa accgtccagg        60
     gtcaggtcga tagtttgaga catagtaaaa actcctttat gattggtcat caattcattg       120
     accttagtaa tcgtagtgac tcactgtgat aaaggttaaa ccttccagca aggttaaggt       180
     caagggggaa atatgaatat tagcgatgtg gcgaaaaaaa ccggtttaac cagcaaagcc       240
     attcggtttt atgaagagaa agggctggtg acgccgccat tacgtagcga aaatggttat       300
     cgcacctaca cgcagaagca tttaaacgag ctgacgttgc tgcgacaggc gaggcaggtg       360
     gggtttaatc tggaagagtg tggcgaactg gtcaatctgt ttaacgatcc gcgacgccat       420
     agcgcagatg tgaaaaagcg gacgctggaa aaggtcgcgg agatcgagcg ccatatcagc       480
     gagctgcaat caatgcgcga tcaactgttg gcgctggcgg agagttgtcc cggcgatgac       540
     agcgccgact gcccgattat tgataatctt tccggctgct gtcatcacaa ggcgcaaaag       600
     ccacgttgat taaacggcac gaatgcgtaa ggtgatgcct tccacggcga tcacttcgac       660
     atgcgtacct gcgcgcaggt tcttcgtcag cgcataccgg ccacgagctg tcgcccgac        719
//

If you have problems or comments...

PBIL Back to PBIL home page