(data stored in SCRATCH zone)

EMBL: AF417208

ID   AF417208; SV 1; linear; genomic DNA; STD; PRO; 750 BP.
XX
AC   AF417208;
XX
DT   02-OCT-2001 (Rel. 69, Created)
DT   02-OCT-2001 (Rel. 69, Last updated, Version 1)
XX
DE   Bacillus subtilis oxidoreductase (ycnD) gene, complete cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-750
RA   Park C.H., Gonzalez C.F., Ackerley D., Keyhan M., Matin A.;
RT   "Molecular engineering of soluble bacterial proteins with chromate
RT   reductase activity";
RL   Unpublished.
XX
RN   [2]
RP   1-750
RA   Gonzalez C.F., Matin A.;
RT   ;
RL   Submitted (06-SEP-2001) to the INSDC.
RL   Microbiology & Immunology, Stanford University, Fairchild Building D-317,
RL   Stanford, CA 94305, USA
XX
DR   MD5; 82679b5d0aa7d295d58bf64c844c61dd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..750
FT                   /organism="Bacillus subtilis"
FT                   /map="438.8"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        1..750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnD"
FT                   /product="oxidoreductase"
FT                   /function="reduces quinone, chromate and nitrocompounds"
FT                   /note="flavoprotein; similar to Bacillus subtillis
FT                   NADPH-flavin oxidoreductase; soluble"
FT                   /db_xref="GOA:P94424"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="PDB:1ZCH"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94424"
FT                   /protein_id="AAL09698.1"
FT                   /translation="MNEVIKSLTDHRSIRSYTDEPVAQEQLDQIIEAVQSAPSSINGQQ
FT                   VTVITVQDKERKKKISELAGGQPWIDQAPVFLLFCADFNRAKIALEDLHDFKMEITNGL
FT                   ESVLVGAVDAGIALGTATAAAESLGLGTVPIGAVRGNPQELIELLELPKYVFPLSGLVI
FT                   GHPADRSAKKPRLPQEAVNHQETYLNQDELTSHIQAYDEQMSEYMNKRTNGKETRNWSQ
FT                   SIASYYERLYYPHIREMLEKQGFKVEK"
XX
SQ   Sequence 750 BP; 223 A; 182 C; 176 G; 169 T; 0 other;
     atgaatgaag tgattaaatc tttaacagac caccgctcga ttcgcagcta cacagatgag        60
     cctgtagctc aggagcaatt ggaccaaatc attgaagcgg tgcaatcagc cccttcttct       120
     atcaacggac agcaagtgac tgtgatcaca gtccaggata aagagcgcaa aaagaaaatc       180
     tccgagctgg caggcggcca gccatggatc gatcaagctc ctgttttcct gctgttctgc       240
     gcagatttta accgggccaa aattgcgctt gaagatctgc atgatttcaa aatggaaatc       300
     acaaatggat tggaatctgt tcttgtcggc gcagtagacg ctggtattgc cctcggcaca       360
     gcaacagcag cggctgagtc actcggactt ggcacagttc cgatcggtgc agttcgcgga       420
     aaccctcaag agctgatcga actgcttgag cttccgaaat acgtgttccc tttatccggc       480
     cttgtcattg ggcatcctgc cgaccgttca gcgaaaaaac cgcgcttgcc gcaggaagct       540
     gtcaatcatc aggaaactta tttgaatcag gatgagctga cgtctcacat tcaggcatac       600
     gacgaacaga tgtctgaata catgaataaa cggacaaacg gaaaagaaac aagaaactgg       660
     tcacagagca tcgcttccta ctatgagcgc ctgtactatc cgcacatccg tgaaatgctt       720
     gaaaaacaag gatttaaagt tgaaaaataa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page