(data stored in SCRATCH zone)

EMBL: AF421961

ID   AF421961; SV 1; linear; genomic DNA; STD; PRO; 2060 BP.
XX
AC   AF421961;
XX
DT   04-OCT-2003 (Rel. 77, Created)
DT   04-OCT-2003 (Rel. 77, Last updated, Version 1)
XX
DE   Bacillus subtilis strain Marburg YqfZ (yqfZ) and YqgA (yqgA) genes,
DE   complete cds; and YqgB (yqgB) gene, partial cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-2060
RA   Margot P.;
RT   "An Orphan Gene Encodes A Highly Expressed Cell Wall Binding Protein
RT   Presents Only in Bacillus subtilis subsp subtilis";
RL   Unpublished.
XX
RN   [2]
RP   1-2060
RA   Margot P.;
RT   ;
RL   Submitted (21-SEP-2001) to the INSDC.
RL   Institut de Genetique et de Biologie Microbiennes, University of Lausanne,
RL   19 Cesar-Roux, Lausanne, VD 1005, Switzerland
XX
DR   MD5; 92725b80989a97f14af014f39e03ff5d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2060
FT                   /organism="Bacillus subtilis"
FT                   /strain="Marburg"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   gene            complement(205..504)
FT                   /gene="yqfZ"
FT   CDS_pept        complement(205..504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqfZ"
FT                   /product="YqfZ"
FT                   /db_xref="GOA:P54483"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54483"
FT                   /protein_id="AAQ04055.1"
FT                   /translation="MKRLTLVCSIVFILFILFYDLKIGTIPIQDLPVYEASAKTAVQEP
FT                   AYKTVKVKPGDTVMSIVGSAGSPDDIVKDFEALNPNVKANAIQAGTAYKFPVYP"
FT   gene            781..1209
FT                   /gene="yqgA"
FT   CDS_pept        781..1209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqgA"
FT                   /product="YqgA"
FT                   /note="CWBP14"
FT                   /db_xref="UniProtKB/TrEMBL:Q71N51"
FT                   /protein_id="AAQ04054.1"
FT                   /translation="MKQGKFSVFLILLLMLTLVVAPKEKAEAASSGWQPVSGISGCKIR
FT                   VITDAYTYTKSATSIDAYAETNGKCGKLNYKSFGVSIVEGGDIGPQYSGYFSSRTPTKK
FT                   FYFSKLPKPTGTPWAVGLSVYKGKAKGAAFVYINPQKR"
FT   gene            complement(1625..>2060)
FT                   /gene="yqgB"
FT   CDS_pept        complement(1625..>2060)
FT                   /codon_start=2
FT                   /transl_table=11
FT                   /gene="yqgB"
FT                   /product="YqgB"
FT                   /db_xref="GOA:Q71N50"
FT                   /db_xref="InterPro:IPR009574"
FT                   /db_xref="UniProtKB/TrEMBL:Q71N50"
FT                   /protein_id="AAQ04056.1"
FT                   /translation="AIGILQNKFVLAIDGQAQEMSYSMMPSELQKKDVIAGLNQNKAMI
FT                   VTVLSALIFLVTAAGKFIEVSFLALIGLIIKNSQKKHLSYHQLWKLSAYSITLSTVFFT
FT                   IMRALEATVPSEFLLNWFVNFVILFLVLKEIPSKKVINKS"
XX
SQ   Sequence 2060 BP; 670 A; 337 C; 382 G; 671 T; 0 other;
     cttcattgtt gccgcctatt gttaaaggtc ccactttgac gggacgcgtt tttgtacgat        60
     gtgtgatttc actcacttgc aatcgctcct taattgtagt tgccgcttct agatataaca       120
     attctagtat ggtttatgtg aatttatttt acaaattaca ttgtaacagt gtcttcgccg       180
     aactgacaag aaattaacgt taaattaagg gtagaccggg aatttatacg ctgttccggc       240
     ttgaatggcg ttagctttca catttggatt cagtgcttca aaatccttta caatgtcatc       300
     cggagaacct gctgatccga ctatcgacat aaccgtatca cccggcttta ccttcaccgt       360
     tttataagcc ggttcttgta cagccgtttt tgctgatgct tcatagacag ggaggtcctg       420
     aatgggtatg gttccaattt taaggtcata aaaaagaata aaaagtataa aaacaatgct       480
     gcatactaag gtgagacgct tcatcgcttt tcctcccgca tacgaaattt tataccatag       540
     tatgcttgtc catttcgatt catgacaaaa gaaaagagac tgcgaatgct cggtttttat       600
     acaggcgctt ttttgacagg atttcttcga ctaaacatta acttcagata gaaaatagaa       660
     aatagtgcaa aattagatca aaaagaggct tttataatat aaaactcgta ttccattatt       720
     tacaatgaac aatggatctg ttaggataat tatgtaatag tttaaaggag gatctacaaa       780
     atgaagcaag gaaaattttc tgtgttttta attttgctac taatgttaac tttggtagtt       840
     gcacctaaag aaaaagcaga ggctgcaagc agtggttggc aaccggtaag tggtatttct       900
     ggttgtaaaa taagagttat tacagatgct tatacatata ctaagagtgc aacatctatt       960
     gatgcttacg ccgaaacaaa tggaaaatgc ggtaaactaa attataagag ctttggtgta      1020
     tctatagttg agggtgggga cattggcccg caatattcag ggtacttttc aagtagaact      1080
     ccaaccaaaa agttttactt cagtaaatta ccaaaaccga caggaacacc ttgggcagta      1140
     ggtttatcag tatataaggg gaaagctaag ggagctgcat ttgtatacat aaacccacaa      1200
     aaaagataac agttcaataa tgagaataga aggaaagaag ataattctaa cttgttgatg      1260
     atttaattct gaaagctagg tgccctattg gtacctggct ttttaaatag caactatctt      1320
     atgtaaatat gttgtgaaag gatgcaaaat attttgccat atgattttaa ctagtctatt      1380
     agttaaaatt taacattatt cttattttgt taaaaacata tgtcaaatgc tgttaagaac      1440
     ttctttcatg ttacatctta ctacttctga tattattgtc cagagcttgt tcttgagtaa      1500
     ttgtagagct ttttttataa atgtatctgt ttaagctcta tacattttat taaatatccc      1560
     ttaagtaaaa agttaatgca aatgctttca cactctctac ttaaaggata aaaataaata      1620
     taatttaact tttattaatt acttttttgg acggaatctc ttttaaaacg agaaacagga      1680
     tgacaaaatt gacaaaccag ttcagcaaaa attcacttgg tacggttgct tctagtgccc      1740
     gcatgattgt aaagaataca gttgaaagtg tgatggaata agcagaaagc ttccagagct      1800
     gatgatagga taaatgtttt ttctgcgaat tcttaatgat taacccgata agcgctaaaa      1860
     acgatacttc aataaatttt cccgctgctg ttacgagaaa aataagagct gagagaacag      1920
     ttacaatcat cgctttattt tggtttaaac ctgcaatgac atcttttttc tgtaactctg      1980
     acggcatcat tgagtaagac atttcttggg cttgtccgtc aatggccaaa acaaatttgt      2040
     tctgaaggat gccgattgcg                                                  2060
//

If you have problems or comments...

PBIL Back to PBIL home page