(data stored in ACNUC10243 zone)

EMBL: AF463524

ID   AF463524; SV 1; linear; mRNA; STD; MUS; 1514 BP.
XX
AC   AF463524;
XX
DT   04-DEC-2002 (Rel. 74, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus ribonucleoprotein heterogeneous nuclear ribonucleoprotein A3
DE   (Hnrnpa3) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1514
RA   Bayarsaihan D.;
RT   ;
RL   Submitted (27-DEC-2001) to the INSDC.
RL   MCDB, Yale University, 266 Whitney Avenue, New Haven, CT 06520, USA
XX
DR   MD5; 02dfdb463969a6a193be068aa26dfd2b.
DR   Ensembl-Gn; ENSMUSG00000059005; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025856; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AKRJ_G0025802; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025828; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025588; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026275; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0025569; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025700; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025662; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025788; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026332; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025120; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000090792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111962; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164947; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055405; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AKRJ_T0055393; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055100; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0055851; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0055053; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055157; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055118; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055258; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055998; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054373; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1514
FT                   /organism="Mus musculus"
FT                   /chromosome="14"
FT                   /map="14D1-D2"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        38..1111
FT                   /codon_start=1
FT                   /gene="Hnrnpa3"
FT                   /product="ribonucleoprotein heterogeneous nuclear
FT                   ribonucleoprotein A3"
FT                   /note="HNRNP-A3; splicing of pre-mRNA"
FT                   /db_xref="GOA:Q8BG05"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1917171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BG05"
FT                   /protein_id="AAN76992.1"
FT                   /translation="MEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVM
FT                   RDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVK
FT                   KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV
FT                   QKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFG
FT                   GRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGY
FT                   GGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPYG
FT                   GGYGSGGGSGGYGSRRF"
FT   misc_feature    74..586
FT                   /gene="Hnrnpa3"
FT                   /note="Region: RRM"
FT   misc_feature    662..955
FT                   /gene="Hnrnpa3"
FT                   /note="Region: Gly-rich region"
XX
SQ   Sequence 1514 BP; 455 A; 201 C; 455 G; 403 T; 0 other;
     ttgaactcga gttggaagag gcgagtccgg tctcaaaatg gagggccatg atccaaagga        60
     accagagcag ctgaggaagc tatttattgg tggtctgagc tttgaaacca cagatgatag       120
     cttaagagaa cattttgaga aatggggcac acttacagac tgtgtggtaa tgagagatcc       180
     ccaaacaaaa cgttccagag gctttggttt tgtgacctac tcttgtgttg aagaggtgga       240
     tgctgcaatg tgtgctcggc cacacaaggt tgatgggcgt gtggtggaac cgaagagagc       300
     tgtttctaga gaggattctg taaagcctgg tgcccattta acggtgaaga aaatttttgt       360
     tggtggtatt aaagaggata cggaagaata taacctgaga gactactttg aaaagtatgg       420
     caagattgaa accatagagg ttatggaaga caggcagagt gggaaaaaga gaggatttgc       480
     ttttgtaact tttgatgatc atgacacagt tgataaaatt gttgttcaga aataccacac       540
     tattaatggg cataattgtg aagtgaaaaa ggccctttct aaacaagaga tgcagtctgc       600
     tggatcacag agaggtcgtg gaggtggatc tggcaacttt atgggtcgtg gaggaaactt       660
     tggaggtggt ggaggaaact ttggtcgtgg aggaaacttt ggtggaagag gtggctatgg       720
     tggtggaggt ggtggcagca gaggtagtta tggaggtggt gatggtggat ataatggatt       780
     tggaggtgat ggtggcaact atggtggtgg tcctggttac agcagtagag gaggttatgg       840
     aggtggtgga ccaggatatg gaaaccaggg tggtggatat ggtggtggag gaggaggcta       900
     tgatggttac aatgaaggag gaaattttgg tggaggtaac tatggtggtg gtggaaacta       960
     taatgacttt ggaaattata gtggacagca acaatcaaat tatggaccca tgaagggggg      1020
     cagttttggt ggaagaagct caggcagtcc ctatggtggt ggctatggat ctggaggtgg      1080
     aagtggtgga tatggtagca gaaggtttta aaataaaaca gaaacggcta cagttcttag      1140
     caggagagag agcgaggagt tgtcaggaaa gctgcaggtt actttgacac agtcgtccca      1200
     aatgcattag aggaactgta aaaatctgcc acagaaggaa cgatgatcca tagtcagaaa      1260
     agttactgca gcttaaacag gaaacccttc ttgttcagga ctgtcatagc cacagtttgc      1320
     aaaaagtgca gctattgatt aatgcaatgt agtgtcaatt agatgtacat tcctgaggtc      1380
     ttttatctgt tgtagctttg tctttttctt tttcttttca ttacatcagg tatattgccc      1440
     tgtaaattgt ggtagtggta ccaggaataa aaaattaagg aatttttaac ttttcaaaaa      1500
     aaaaaaaaaa aaaa                                                        1514
//

If you have problems or comments...

PBIL Back to PBIL home page